DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Pdzrn3

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_061372.2 Gene:Pdzrn3 / 55983 MGIID:1933157 Length:1063 Species:Mus musculus


Alignment Length:234 Identity:59/234 - (25%)
Similarity:103/234 - (44%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLT--- 62
            |||:|:...|.||.:|.|.:|..|||:|: ::.|.|.||..|:..|::|:..||....|.|:   
Mouse     1 MGFELDRFDGDVDPDLKCALCHKVLEDPL-TTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKE 64

  Fly    63 -SHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNP---------------- 110
             :|::|:.||    :.:|.|||..:..||.:::.|::...|:..|:..|                
Mouse    65 LNHVLPLKRL----ILKLDIKCAHAARGCGRVVKLQDLPEHLERCDFAPARCRHAGCGQLLLRRD 125

  Fly   111 -----------KVVVECSKGCGMKVPKDE-----------MSRHNCVFELR--ELVEKLAKEVSD 151
                       :.|..|.:|||:.:...|           :..||...:.|  .|.:.|.||...
Mouse   126 VEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALR 190

  Fly   152 LKQKQSDMEEQSSSQRREMEL--------FQYYIAALRS 182
            ..:::..:..|.::.:.|:::        |..|.|.|.|
Mouse   191 AGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/36 (39%)
USP8_interact 137..319 CDD:286082 12/56 (21%)
Pdzrn3NP_061372.2 RING 17..57 CDD:238093 15/40 (38%)
Sina 69..>132 CDD:302762 13/66 (20%)
PDZ 246..338 CDD:214570
PDZ_signaling 424..488 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..798
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..853
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.