DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf2b

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_005165556.1 Gene:traf2b / 557526 ZFINID:ZDB-GENE-030131-5345 Length:532 Species:Danio rerio


Alignment Length:314 Identity:65/314 - (20%)
Similarity:103/314 - (32%) Gaps:125/314 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQIC---PV------------DRSGLLTSHLVP 67
            |..|.|:|.:|.| ::|.|.||..|.      ||:.   |:            :.:.:|...:..
Zfish    45 CQQCKDILRKPFQ-AQCGHRFCVFCF------KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAF 102

  Fly    68 VSRLMRNMLSRLKIKCTFSQSGCAQMLALEEF-----------RTHVAACE----------HN-- 109
            .....|..:..|..||  ...||:....|::|           |....||:          ||  
Zfish   103 PDNAARREIDSLPAKC--PNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNER 165

  Fly   110 ----------------------------PKVVVECSKGCG-MKVPKDEMSRHN---------CVF 136
                                        .|..::| |.|| .|:|:::...|.         |.|
Zfish   166 ECEARTLNCKYCKVTFNFKEIKAHDEICQKFPMQC-KDCGKKKIPREKFQEHTKSCAKSKSACQF 229

  Fly   137 ELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIGEQLDRFSLMQ 201
              ||:..:..  |.:.||::   .||:|.    ||..:..:|.|.|........||         
Zfish   230 --REIGCRAV--VDNCKQQE---HEQTSI----MEHLRLMLALLSSMRLRAEGAGE--------- 274

  Fly   202 W----GHGL-------PLANIHTWG--------SLISTPDNPMHLMVRDVLRES 236
            |    |.||       |.|..|..|        ..::|.:|.:.::.::|.|.:
Zfish   275 WQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/39 (33%)
USP8_interact 137..319 CDD:286082 27/119 (23%)
traf2bXP_005165556.1 RING 44..86 CDD:238093 14/47 (30%)
zf-TRAF 189..246 CDD:280357 15/64 (23%)
TRAF_BIRC3_bd 307..359 CDD:293278 4/22 (18%)
MATH_TRAF2 365..528 CDD:239747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.