DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf6

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001038217.1 Gene:traf6 / 554561 ZFINID:ZDB-GENE-030131-5735 Length:542 Species:Danio rerio


Alignment Length:318 Identity:76/318 - (23%)
Similarity:118/318 - (37%) Gaps:80/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CPICTDVLEEPVQSSECEHAFCRACIDKWMIQK-QICPVDRSGLLTSHLVPVSRLMRNMLSRLKI 81
            ||||...|...|| :.|.|.||.:||.|.:... |.||||...||...|.|.:...|.:|| |.:
Zfish    71 CPICLMGLRSAVQ-TPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILS-LTV 133

  Fly    82 KCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH---NCVFELRELVE 143
            ||  |..||::.:.|.:...|::.|..   ....|.: |...||...:..|   :|:..:....:
Zfish   134 KC--SNFGCSEKMELRQLEKHLSQCRF---ATAPCPQ-CQESVPISHLDEHKSQHCLQRIMTCPD 192

  Fly   144 KLAKEVSDLKQKQSDMEEQSSS--QRREMELFQYYIAALRSTN-----------------PMLRN 189
            .....|..:||........:::  :..||||.:..:|....|:                 .|.||
Zfish   193 CAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRN 257

  Fly   190 -IGEQLDRFSLMQWGH-------------GLPLANIH----TWGSLISTPDNPMHLMVRDVLRES 236
             :.:.:..|:.|...:             .:|.|..|    ..|:...:||:            .
Zfish   258 ELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDS------------C 310

  Fly   237 GCPMHMLNM----------LVERCHEDRWPEGLMTLDDRRENQHLMSRYVTRLVPGLV 284
            .|...:||:          ||   .:|:....|...:|.::||      ||.|...||
Zfish   311 QCKQELLNLRETVLELEGRLV---RQDQQIRELCIHNDTQKNQ------VTELRRKLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 16/37 (43%)
USP8_interact 137..319 CDD:286082 35/195 (18%)
traf6NP_001038217.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..54
RING 71..108 CDD:214546 16/37 (43%)
zf-TRAF 205..262 CDD:280357 9/56 (16%)
MATH_TRAF6 375..521 CDD:239745
Substrate binding. /evidence=ECO:0000250 489..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.