DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and RNF138

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001178253.2 Gene:RNF138 / 51444 HGNCID:17765 Length:245 Species:Homo sapiens


Alignment Length:173 Identity:37/173 - (21%)
Similarity:68/173 - (39%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI-CPVDRSGLLTSH 64
            |..||:....:.:::..||:|.:||:.||:::.|:|.|||.|....|.:... ||:.|..:....
Human     1 MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRE 65

  Fly    65 LVPVSRL--MRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAAC-----EHNPKVVVECSKGCGM 122
            .....|.  :.|::.:....|..    ||:.:.....|.|..:|     |:....::.     ..
Human    66 RACPERALDLENIMRKFSGSCRC----CAKQIKFYRMRHHYKSCKKYQDEYGVSSIIP-----NF 121

  Fly   123 KVPKDEMSRHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSS 165
            ::.:|.:...|            ..|.|.....::..|..|||
Human   122 QISQDSVGNSN------------RSETSTSDNTETYQENTSSS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 15/37 (41%)
USP8_interact 137..319 CDD:286082 6/29 (21%)
RNF138NP_001178253.2 RING-HC_RNF138 14..59 CDD:319458 16/44 (36%)
zf_C2HC_14 80..112 CDD:408358 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..154 8/40 (20%)
zf-Di19 156..215 CDD:398954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.