DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf4

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005074.1 Gene:traf4 / 448646 XenbaseID:XB-GENE-990354 Length:470 Species:Xenopus tropicalis


Alignment Length:137 Identity:39/137 - (28%)
Similarity:67/137 - (48%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI-CPVDRSGLLTSHL 65
            |:|.. .:..:..:.:||:|...:.||||.|.|.|.||..|:.:::.:... ||.|:..|..:.:
 Frog     3 GYDYK-FLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKI 66

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMK-VPKD-- 127
            .| .|.:...:..|.|:|..|:.||.....|::.:.|:..|..|   |:.|...|..| :.:|  
 Frog    67 YP-DRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFN---VIPCPNRCSTKLIRRDLP 127

  Fly   128 EMSRHNC 134
            |..:|:|
 Frog   128 EHMQHDC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/37 (38%)
USP8_interact 137..319 CDD:286082
traf4NP_001005074.1 mRING-HC-C3HC3D_TRAF4 15..59 CDD:319555 16/43 (37%)
modified RING-HC finger (C3HC3D-type) 18..57 CDD:319555 15/38 (39%)
PLN03086 <88..211 CDD:178635 14/50 (28%)
zf-TRAF 102..156 CDD:280357 11/36 (31%)
zf-TRAF 210..269 CDD:280357
MATH_TRAF4 308..463 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.