DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf4b

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_997982.1 Gene:traf4b / 404035 ZFINID:ZDB-GENE-040305-2 Length:478 Species:Danio rerio


Alignment Length:388 Identity:90/388 - (23%)
Similarity:143/388 - (36%) Gaps:96/388 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI-CPVDRSGLLTSHL 65
            |.||. .:.....:..||:|...:.||||.|.|.|.||..|:.:::.:... ||.|:..|..:.:
Zfish     3 GLDLK-FLERPRRKFYCPLCEKPMREPVQVSTCGHRFCDTCLQEYLSEGVFTCPEDQLPLDYAKI 66

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            .|...|.:.:|| |.|:|..|:.||......:..:.|::.||.|   ||.|...|.:|:.:.|:.
Zfish    67 FPDLELEQQILS-LPIRCIHSEEGCRWTAQNKLLQAHLSVCEFN---VVSCPNRCSVKLLRRELP 127

  Fly   131 ---RHNCVFELREL-----VEKLAKEVSDLKQ----KQSDMEEQSSSQRREMELF-QYYIA-ALR 181
               :|:|.  .|:|     .|:...|..:..|    ::|...|.....|....|. |:.:: .|:
Zfish   128 EHLQHDCA--KRKLHCDHCGEQFTGEAYENHQGVCPEESVYCENKCGARMVRRLLAQHSVSECLK 190

  Fly   182 STNP-----------MLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPM-HL------- 227
            ...|           .::|..:|..||         |:...:..|:...|.|..| |:       
Zfish   191 RKLPCRYCKKEFLYDTIQNHQQQCPRF---------PMQCPNRCGTPGITRDTLMAHVKEGCSTA 246

  Fly   228 MVRDVLRESGCPMHMLNMLVERCHEDRWPEGLMTL------------DDRRENQHL--------- 271
            ||....:|:||........|.|..|:..|..|..|            |.||..:.|         
Zfish   247 MVLCPFKEAGCKHRSPKTGVARHLEEAAPTHLSLLCGLVNRQRLELRDLRRRMEELSGSRDGTLL 311

  Fly   272 --MSRYVTRLVPGLVIGKPCVVVL-----------------------GGENTHMPENLRPILG 309
              ::.:..||.........|:.:.                       .||:|||...||.:.|
Zfish   312 WKLTDFSQRLQEAKTRTSGCLELFSPAFYSHNYGYRLQVSAFLNGNGSGEDTHMSVYLRVLPG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/37 (38%)
USP8_interact 137..319 CDD:286082 48/249 (19%)
traf4bNP_997982.1 RING 18..55 CDD:238093 13/36 (36%)
zf-TRAF 102..156 CDD:280357 16/58 (28%)
zf-TRAF 156..210 CDD:280357 8/53 (15%)
zf-TRAF 210..269 CDD:280357 15/67 (22%)
MATH_TRAF4 308..471 CDD:239750 11/67 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.