DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and elgi

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster


Alignment Length:318 Identity:144/318 - (45%)
Similarity:213/318 - (66%) Gaps:4/318 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHL 65
            ||:|:|...|.|||||.||||:.|||:|:|:..|||||||.||::|:.::..|||||:.|.|::|
  Fly     1 MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANL 65

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            ..|.|::||:||||.|.|..:..||..:|.|:.:.:|:..|.||||....|.||||..:||||:.
  Fly    66 RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELK 130

  Fly   131 RHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIGEQLD 195
            .||||.|||.|:.|..:::.:||.:.:|.:...:..:||::||:.::.|:|.:||.:|.|.:|::
  Fly   131 DHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAMRVSNPAMRAIADQME 195

  Fly   196 RFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPMHMLNMLVERCHEDRWPEGLM 260
            |..:::|...||.|.:..||.:|||||:.:.||::..|.|||||.|:|:.|:|.|||.|||.||.
  Fly   196 RDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCPPHILDSLMEFCHERRWPRGLS 260

  Fly   261 TLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGENTHMPENLRPILGLVMIFVDGV 318
            :|:.|:.|:.:...||.|.:|    ||..|:||..:|.||.|::....||||||..|:
  Fly   261 SLETRQTNRRIYDNYVCRRIP----GKQAVLVLSCDNLHMTEDVMIDPGLVMIFAHGI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 20/36 (56%)
USP8_interact 137..319 CDD:286082 74/182 (41%)
elgiNP_001261904.1 RING 17..55 CDD:238093 20/37 (54%)
Sina 83..>157 CDD:302762 31/73 (42%)
USP8_interact 137..315 CDD:286082 74/182 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.