DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf3

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_038968511.1 Gene:Traf3 / 362788 RGDID:1304633 Length:610 Species:Rattus norvegicus


Alignment Length:269 Identity:60/269 - (22%)
Similarity:94/269 - (34%) Gaps:95/269 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELICPICTDVLEEPVQSSECEHAFCRACIDKWM---------IQKQIC--PVDRSGLLTSHL 65
            |:::..|..|..||..|.| :||.|.||.:|:...:         .|:.|.  .|.:.......:
  Rat    89 VEDKYKCEKCRLVLCNPKQ-TECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREI 152

  Fly    66 VPVSRLMRN-------------MLSRLKIKCTFSQ-----SGCAQMLALEEFRTHV--------A 104
            :.:....||             :|..||.:|.|.:     :.|.:.:...:.|.||        |
  Rat   153 LALQIYCRNEGRGCVEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRRDLRDHVEKACKYREA 217

  Fly   105 ACEH-----------------NPKVVVECSKGCGMK-VPKDEMS----------------RHNCV 135
            .|.|                 .|.|||.|...|.:: :.:.|:|                |:.||
  Rat   218 TCAHCKSQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV 282

  Fly   136 FE--------------------LRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAAL 180
            |:                    |:|....|.|:|| |.|.:| :|:..|.|....::..:.|...
  Rat   283 FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVS-LLQNES-VEKNKSIQSLHNQICSFEIEIE 345

  Fly   181 RSTNPMLRN 189
            |. ..||||
  Rat   346 RQ-KEMLRN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/47 (30%)
USP8_interact 137..319 CDD:286082 18/73 (25%)
Traf3XP_038968511.1 RING-HC_TRAF3 93..134 CDD:319554 12/41 (29%)
zf-TRAF 178..234 CDD:280357 11/55 (20%)
zf-TRAF 239..289 CDD:424248 12/49 (24%)
Smc <294..>475 CDD:224117 18/63 (29%)
MATH_TRAF3 420..605 CDD:239746
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.