DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf7

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006246044.1 Gene:Traf7 / 360491 RGDID:1559653 Length:670 Species:Rattus norvegicus


Alignment Length:326 Identity:62/326 - (19%)
Similarity:106/326 - (32%) Gaps:124/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLVPVSRL-MRNMLSR 78
            :|.|.:|..|.::||.:: |.|.|||.|    .::.:.||||.:.|    .|.|:.: :...:..
  Rat   128 KLCCQLCCSVFKDPVITT-CGHTFCRRC----ALKSEKCPVDNAKL----TVVVNNIAVAEQIGE 183

  Fly    79 LKIKC---------------TFSQSGCAQMLALEEFRTHVAACEHNPKVVVEC------------ 116
            |.|.|               .....||...:.|...:.|.::|::.|   |.|            
  Rat   184 LFIHCRHGCRAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRP---VRCPNNPSCPPLLKM 245

  Fly   117 ----------------SK-GCGMKVPKDEMSRH--NCVFE------------------------- 137
                            || ||.....:|....|  .|.||                         
  Rat   246 NLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQ 310

  Fly   138 ----LRELVEKLAKEVSDLK-----------QKQSDMEEQSSSQRREMELFQYYIAALRSTNPML 187
                ||.::.||::::..|:           :.||.:.|.....||:..:.          |..|
  Rat   311 EIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASML----------NDEL 365

  Fly   188 RNIGEQLDRFSLMQW-------------GHGLPL--ANIHTWGSLISTPDNPMHLMVRDVLRESG 237
            .:|..:|:...|..:             ||..|:  ..:::.|.|:.:..:...:.|.|......
  Rat   366 SHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK 430

  Fly   238 C 238
            |
  Rat   431 C 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 12/36 (33%)
USP8_interact 137..319 CDD:286082 24/157 (15%)
Traf7XP_006246044.1 mRING-HC-C3HC3D_TRAF7 129..165 CDD:319558 15/40 (38%)
Sina 207..>281 CDD:418524 14/76 (18%)
DD_cGKI 282..322 CDD:418404 5/39 (13%)
PRK03918 283..>373 CDD:235175 15/99 (15%)
WD40 388..668 CDD:238121 8/44 (18%)
WD40 repeat 443..477 CDD:293791
WD40 repeat 482..517 CDD:293791
WD40 repeat 527..556 CDD:293791
WD40 repeat 562..596 CDD:293791
WD40 repeat 604..639 CDD:293791
WD40 repeat 646..668 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.