DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf4

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster


Alignment Length:200 Identity:43/200 - (21%)
Similarity:67/200 - (33%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH---NCVFELRELVEK 144
            |...:.||.....|.:.:.|:.||:|:   ..:|...||.::|:..|:.|   .|... |...|.
  Fly   106 CIHHKQGCKWSDELRKLKGHLNACKHD---ATQCPNKCGAQIPRIMMTDHLQYTCTMR-RTRCEF 166

  Fly   145 LAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAAL--------RSTNPMLRNIGEQLDRFSLMQ 201
            ...|.|.     :.:||.:.|..:|    ..|..|.        |.|....::..::|.|.:..|
  Fly   167 CQSEFSG-----AGLEEHNGSCGQE----PVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQ 222

  Fly   202 WGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPMHMLNMLVERCHEDRWPEGLMTLDDRR 266
            .........:|.    ...|..|:           .||        :||.....|.|.:....|.
  Fly   223 REFSADTLPLHA----AQCPRAPL-----------ACP--------QRCDAGPIPRGELEAHLRD 264

  Fly   267 ENQHL 271
            |.|.|
  Fly   265 ECQSL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524
USP8_interact 137..319 CDD:286082 27/142 (19%)
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 26/109 (24%)
zf-TRAF 233..292 CDD:424248 12/59 (20%)
MATH_TRAF4 331..479 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.