DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf-like

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster


Alignment Length:82 Identity:23/82 - (28%)
Similarity:32/82 - (39%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH--NCVFELRELV 142
            |..|.|    |.:....:.|..|:..|   .:|:.||..||...:|:..|..|  .|......|.
  Fly    38 KSSCLF----CNEWFDAQTFTEHLIHC---GQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLS 95

  Fly   143 EKLAKEVS-DLKQKQSD 158
            .:....|| |...:|||
  Fly    96 NQQRMSVSMDRLDRQSD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524
USP8_interact 137..319 CDD:286082 7/23 (30%)
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 10/36 (28%)
MATH_TRAF_C 334..473 CDD:238168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.