DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf6

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001101224.1 Gene:Traf6 / 311245 RGDID:1306853 Length:530 Species:Rattus norvegicus


Alignment Length:401 Identity:93/401 - (23%)
Similarity:149/401 - (37%) Gaps:102/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CPICTDVLEEPVQSSECEHAFCRACIDKWMIQK-QICPVDRSGLLTSHLVPVSRLMRNMLSRLKI 81
            ||||...|.|.|| :.|.|.||:|||.|.:... ..||||...||.:.|.|.:...|.:|| |.:
  Rat    70 CPICLMALREAVQ-TPCGHRFCKACITKSIRDAGHKCPVDNEILLENQLFPDNFAKREILS-LTV 132

  Fly    82 KCTFSQSGCAQMLALEEFRTHVAACEH-----------------NPKVVVECSK------GCGMK 123
            ||  ...||.|.:.|.....|...||.                 |..::.:|.:      .|.:.
  Rat   133 KC--PNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIEDCPRRQVSCVNCAVP 195

  Fly   124 VPKDEMSRHNCVFELRELVEKLAKEVSDLKQKQS--DMEEQSSSQRREMELFQYYIAALRSTNPM 186
            :|.:|...|:....|..::.:....:...:|..:  |::..::.......:|..:....|  |.:
  Rat   196 MPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPVPCTFSVFGCHEKMQR--NHL 258

  Fly   187 LRNIGE--QLDRFSLMQWGHGLPL------ANIHTWGSLISTPDNPMH----------LMVRD-V 232
            .|::.|  ||....|.|..|.:.|      |:..:.|   ..|::|.:          |:.:| .
  Rat   259 ARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRG---CRPEDPNYEETVKQLEGRLVRQDHQ 320

  Fly   233 LRESGCPMHMLNMLVE------RCHEDRWPE-------GLMTLDDRRENQHLMSRYVTRLV---- 280
            :||....|...:|.|.      |..||:..|       |:..........||.|:...|.|    
  Rat   321 IRELTAKMETQSMHVSELKRTIRSLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHS 385

  Fly   281 PGLVIGKP-----------------C-------VVVLGGE-NTHMPENLRPILGLVMIFVDGVNE 320
            ||...|:|                 |       |..:.|| ::|:|   .|..|.:.:.:...:|
  Rat   386 PGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLP---WPFQGTIRLTILDQSE 447

  Fly   321 VIF---GEEII 328
            .:.   .||::
  Rat   448 AVIRQNHEEVM 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 17/37 (46%)
USP8_interact 137..319 CDD:286082 47/244 (19%)
Traf6NP_001101224.1 Interaction with TAX1BP1. /evidence=ECO:0000250 1..362 73/300 (24%)
mRING-HC-C3HC3D_TRAF6 67..124 CDD:319557 24/54 (44%)
PLN03086 <132..219 CDD:178635 16/88 (18%)
TRAF6_Z2 157..183 CDD:407885 1/25 (4%)
zf-TRAF 204..261 CDD:280357 7/58 (12%)
DUF460 <273..>352 CDD:421465 18/81 (22%)
MATH_TRAF6 359..508 CDD:239745 21/103 (20%)
Interaction with TANK. /evidence=ECO:0000250|UniProtKB:Q9Y4K3 363..530 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.