DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf4

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001100487.1 Gene:Traf4 / 303285 RGDID:1306708 Length:470 Species:Rattus norvegicus


Alignment Length:137 Identity:41/137 - (29%)
Similarity:64/137 - (46%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI-CPVDRSGLLTSHL 65
            |||.. .:......|:||:|...:.||||.|.|.|.||..|:.:::.:... ||.|:..|..:.:
  Rat     3 GFDYK-FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKI 66

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            .|...|...:|. |.|:|..|:.||.....|...:.|:..|..|   ||.|...|..|:.:.::.
  Rat    67 YPDPELEVQVLG-LAIRCIHSEEGCRWSGPLRHLQGHLNTCSFN---VVPCPNRCPAKLSRRDLP 127

  Fly   131 ---RHNC 134
               :|:|
  Rat   128 AHLQHDC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/37 (38%)
USP8_interact 137..319 CDD:286082
Traf4NP_001100487.1 mRING-HC-C3HC3D_TRAF4 15..59 CDD:319555 17/43 (40%)
zf-TRAF 102..156 CDD:280357 10/36 (28%)
zf-TRAF 210..269 CDD:280357
MATH_TRAF4 308..463 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.