DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Rnf151

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001100457.1 Gene:Rnf151 / 302977 RGDID:1309302 Length:238 Species:Rattus norvegicus


Alignment Length:170 Identity:50/170 - (29%)
Similarity:77/170 - (45%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |:|||......|...:|.:|..||:.|:: ..|.|.||:.||.:|:.::..||..|..:....:|
  Rat     4 GYDLNLFASPPDCNFLCSVCHGVLKRPMR-LPCSHIFCKKCIFQWLARQNTCPCCRKEVKRRKMV 67

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGC-----------------------------AQML--ALEEFR 100
            .|::| |..:.||::||..:.:||                             ||:|  .|:|.|
  Rat    68 QVNKL-RKTIGRLQVKCKNAAAGCLVTCPLAHRKGHQDSCPFELMACPNEGCTAQVLRGVLDEHR 131

  Fly   101 THVAACEHNPKVVVECSKGCGMKVPKDEMSRHNCVFELRE 140
            .|   |:.|.:  ..|..|||..:...|..:|||..|||:
  Rat   132 QH---CQQNGQ--QRCPLGCGATLAALEGEQHNCYRELRD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/36 (36%)
USP8_interact 137..319 CDD:286082 3/4 (75%)
Rnf151NP_001100457.1 RING_Ubox 20..58 CDD:418438 14/38 (37%)
Sina 83..>134 CDD:418524 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.