DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf6

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001290202.1 Gene:Traf6 / 22034 MGIID:108072 Length:530 Species:Mus musculus


Alignment Length:431 Identity:80/431 - (18%)
Similarity:138/431 - (32%) Gaps:162/431 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CPICTDVLEEPVQSSECEHAFCRACIDKWMIQK-QICPVDRSGLLTSHLVPVSRLMRNMLSRLKI 81
            ||||...|.|.|| :.|.|.||:|||.|.:... ..||||...||.:.|.|.:...|.:|| |.:
Mouse    70 CPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILS-LTV 132

  Fly    82 KCTFSQSGCAQMLALEEFRTHVAACEH-----------------NPKVVVECSK----------- 118
            ||  ...||.|.:.|.....|...||.                 |..::.:|.:           
Mouse   133 KC--PNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVS 195

  Fly   119 ----------------------------------------------------GCGMKVPKDEMSR 131
                                                                ||..|:.::.::|
Mouse   196 MAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLAR 260

  Fly   132 H---NCVFELRELVE-----KLAKEVSD------------------LKQKQSDMEEQSSSQRR-- 168
            |   |....:|.|.:     .||....|                  :||.:|.:..|....|.  
Mouse   261 HLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELT 325

  Fly   169 -EMELFQYYIAALRSTNPMLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDV 232
             :||....|:..|:.|   :|.:.:::......|. :|:.:..|..:|..:.:.:....:::...
Mouse   326 AKMETQSMYVGELKRT---IRTLEDKVAEMEAQQC-NGIYIWKIGNFGMHLKSQEEERPVVIHSP 386

  Fly   233 LRESGCP-------MHMLNMLVERCHEDRWPEGLMTLDDRRENQHLMSRYVTRLVPGLVIGKPCV 290
            ...:|.|       :|:.....:||                      :.|::..|.         
Mouse   387 GFYTGRPGYKLCMRLHLQLPTAQRC----------------------ANYISLFVH--------- 420

  Fly   291 VVLGGENTHMPENLRPILGLVMIFVDGVNEVIF---GEEII 328
            .:.|..::|:|   .|..|.:.:.:...:|.:.   .||::
Mouse   421 TMQGEYDSHLP---WPFQGTIRLTILDQSEALIRQNHEEVM 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 17/37 (46%)
USP8_interact 137..319 CDD:286082 32/214 (15%)
Traf6NP_001290202.1 Interaction with TAX1BP1. /evidence=ECO:0000250 1..362 63/299 (21%)
RING 69..107 CDD:238093 17/37 (46%)
zf-TRAF 204..261 CDD:280357 3/56 (5%)
SlyX 304..>356 CDD:294687 11/54 (20%)
MATH_TRAF6 359..508 CDD:239745 18/134 (13%)
Interaction with TANK. /evidence=ECO:0000250|UniProtKB:Q9Y4K3 363..530 17/130 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.