Sequence 1: | NP_001285905.1 | Gene: | CG9014 / 34777 | FlyBaseID: | FBgn0028847 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035763.2 | Gene: | Traf5 / 22033 | MGIID: | 107548 | Length: | 558 | Species: | Mus musculus |
Alignment Length: | 305 | Identity: | 61/305 - (20%) |
---|---|---|---|
Similarity: | 107/305 - (35%) | Gaps: | 88/305 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACID--KWMIQKQICPVDRSGLLTSHLVPVSRL 71
Fly 72 MRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAAC------------------------------ 106
Fly 107 ---------------------EHN--PKVVVECSKGCGMKVPKDEMSRH---------NCVF--- 136
Fly 137 ------ELRELVEKLAKEVSD----LKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIG 191
Fly 192 EQLDRFSLMQWGHGLPLANIHTWGSLISTPDNP--MHLMVRDVLR 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9014 | NP_001285905.1 | zf-C3HC4 | 18..55 | CDD:278524 | 14/38 (37%) |
USP8_interact | 137..319 | CDD:286082 | 22/104 (21%) | ||
Traf5 | NP_035763.2 | mRING-HC-C3HC3D_TRAF5 | 43..85 | CDD:319556 | 16/42 (38%) |
zf-TRAF | 128..183 | CDD:280357 | 2/54 (4%) | ||
zf-TRAF | 185..241 | CDD:424248 | 10/55 (18%) | ||
Smc | <237..>419 | CDD:224117 | 22/101 (22%) | ||
Interaction with EIF2AK2/PKR. /evidence=ECO:0000250 | 345..558 | ||||
MATH_TRAF5 | 404..551 | CDD:239749 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |