DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf1

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001313530.1 Gene:Traf1 / 22029 MGIID:101836 Length:409 Species:Mus musculus


Alignment Length:233 Identity:51/233 - (21%)
Similarity:84/233 - (36%) Gaps:90/233 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CP--ICTDVLEEPVQSSECEHAFCRACIDKWM--IQKQICPVDRSGLLTSHLVPVS-------RL 71
            ||  .|.|..|..|.   |    |.||:.:.:  .:.:|||..|:    .:|.|||       ..
Mouse    16 CPPAPCQDPSEPRVL---C----CTACLSENLRDDEDRICPKCRA----DNLHPVSPGSPLTQEK 69

  Fly    72 MRNMLSRLKIKCTFSQSGCA----------------------QMLALEEFRTH------------ 102
            :.:.::..:|.|.|:..||:                      .:..|:|:::.            
Mouse    70 VHSDVAEAEIMCPFAGVGCSFKGSPQSMQEHEATSQSSHLYLLLAVLKEWKSSPGSNLGSAPMAL 134

  Fly   103 ---------VAACEHNPKVVVECSKG--CGMKVPKDEMSRHNCVFE--LRELVEKLA-------- 146
                     .||.|....:.|:|.:.  |   ..::|::..:.|.|  |.:|.|||.        
Mouse   135 ERNLSELQLQAAVEATGDLEVDCYRAPCC---ESQEELALQHLVKEKLLAQLEEKLRVFANIVAV 196

  Fly   147 --KEV--------SDLKQKQSDMEEQSSSQRREMELFQ 174
              |||        :.:.|.|.|.|...|.::|.:||.|
Mouse   197 LNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 12/40 (30%)
USP8_interact 137..319 CDD:286082 18/58 (31%)
Traf1NP_001313530.1 SMC_prok_B <126..257 CDD:274008 26/112 (23%)
TRAF_BIRC3_bd 180..237 CDD:374713 17/55 (31%)
MATH_TRAF1 260..406 CDD:239748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.