powered by:
Protein Alignment CG9014 and trf-2
DIOPT Version :9
Sequence 1: | NP_001285905.1 |
Gene: | CG9014 / 34777 |
FlyBaseID: | FBgn0028847 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491534.2 |
Gene: | trf-2 / 172151 |
WormBaseID: | WBGene00022454 |
Length: | 335 |
Species: | Caenorhabditis elegans |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 17/36 - (47%) |
Gaps: | 1/36 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 IKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVEC 116
|.|.|.:.||.:.....|.:.||.. :.|..:|:.|
Worm 84 IDCPFKEHGCHKKGENSEVKRHVRD-DRNLHLVLLC 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0297 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D918518at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.