DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and RNF151

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_005255186.1 Gene:RNF151 / 146310 HGNCID:23235 Length:254 Species:Homo sapiens


Alignment Length:257 Identity:64/257 - (24%)
Similarity:100/257 - (38%) Gaps:65/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |:|||......|...:|.:|..||:.|.: ..|.|.||:.||.:|:.:::.||..|..:....:|
Human    13 GYDLNLFASPPDSNFVCSVCHGVLKRPAR-LPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVV 76

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAAC----------------------EHN 109
            .:::| |..:.||::||..:.:||.....|...:.|..:|                      ||.
Human    77 HMNKL-RKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHR 140

  Fly   110 PKV----VVECSKGCGMKVPKDEMSRHNCVFEL-----------RELVEKLAKEVSDLKQKQSDM 159
            ...    ...|..|||..:...|.:||||..||           |.|:..|.:.|..|       
Human   141 QHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWL------- 198

  Fly   160 EEQSSSQRREMELFQYYI---AALRSTNPMLR-------NIGEQLDRFSLMQWGHGLPLANI 211
            ::.:|..|||:.....::   .||....|...       |:|.::         .|.|.|||
Human   199 DQATSVVRRELAELSNFLEEDTALLEGAPQEEAEAAPEGNVGAEV---------VGEPRANI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/36 (36%)
USP8_interact 137..319 CDD:286082 21/96 (22%)
RNF151XP_005255186.1 RING 29..70 CDD:238093 15/41 (37%)
Sina 92..>139 CDD:302762 6/46 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.