DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and rnf151

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_004918118.1 Gene:rnf151 / 101733072 XenbaseID:XB-GENE-6467161 Length:212 Species:Xenopus tropicalis


Alignment Length:196 Identity:57/196 - (29%)
Similarity:88/196 - (44%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |:|:.......|.:|:|.||..|:..||..| |.|.|||.||.:|:.:::.||..|:.:.....|
 Frog     4 GYDIELFTKTPDYDLLCSICHGVMRCPVMIS-CGHIFCRNCIMQWLKRQRTCPCCRTEVRGKLYV 67

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHN---------PKVVV-------- 114
            .:.:|.|. ::||.:||...|:||....||...:.|...|.:.         |..|:        
 Frog    68 LMHKLKRK-INRLDVKCPNEQNGCPAHFALVHSQEHAEYCAYGAVPCSNEGCPAEVLRKDMCDHI 131

  Fly   115 --------ECSKGCGMKVPKDEMSRHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREME 171
                    .|..|||..:..:....|||   .:||.|..||::..||||.:.||.......|:::
 Frog   132 HNCRYWRQHCHMGCGTLLHPENRETHNC---YQELKEDYAKQLYKLKQKANRMETICCQISRQLQ 193

  Fly   172 L 172
            :
 Frog   194 M 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 16/36 (44%)
USP8_interact 137..319 CDD:286082 12/36 (33%)
rnf151XP_004918118.1 RING 20..61 CDD:238093 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.