DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf3

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002938036.2 Gene:traf3 / 100498216 XenbaseID:XB-GENE-968262 Length:569 Species:Xenopus tropicalis


Alignment Length:358 Identity:60/358 - (16%)
Similarity:113/358 - (31%) Gaps:157/358 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELICPICTDVLEEPVQSSECEHAFCRACID------------------------------KW 46
            |:|:..|..|..||..|.| :||.|.||..|::                              :.
 Frog    50 VEEKYKCEKCRLVLCNPRQ-TECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREV 113

  Fly    47 MIQKQICPVDRSG---LLTSHLVPVSRLMRNMLSRLKIKCTFSQ-----SGCAQMLALEEFRTHV 103
            :..:..|..:..|   |:|         :.|:|..||..|.|.:     :.|.:.:..::...|:
 Frog   114 LALQMFCRNETRGCKELIT---------LGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHI 169

  Fly   104 -AACEHN------------------------PKVVVECSKGCGMK-VPKDEMS------------ 130
             ..|::.                        |.||:.|...|.:| :.:.|::            
 Frog   170 EKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPST 234

  Fly   131 ----RHNCVF----------ELRELVE--KLAKEVSD-LKQKQSDMEEQSSSQRREMELFQYYIA 178
                |:.|.|          |....|:  .|.||.|: |:.|.|.::.:||.:.:.:::....:.
 Frog   235 CSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMC 299

  Fly   179 A--------------------------------LRSTNPMLRNI---GEQLD-----------RF 197
            :                                |:..:..:||:   |::.|           |.
 Frog   300 SFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRL 364

  Fly   198 SLMQ--------WGHGLPLANIHTWGSLISTPD 222
            |.::        |..|:....|:....::|..|
 Frog   365 SQLEVMAKNAASWNPGVLETQINRHDQMLSVHD 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/66 (20%)
USP8_interact 137..319 CDD:286082 23/143 (16%)
traf3XP_002938036.2 RING-HC_TRAF3 54..95 CDD:319554 12/41 (29%)
RING-HC finger (C3HC4-type) 56..94 CDD:319554 12/38 (32%)
zf-TRAF 139..195 CDD:280357 7/55 (13%)
zf-TRAF 200..250 CDD:280357 10/49 (20%)
Smc <255..>372 CDD:224117 18/116 (16%)
MATH_TRAF3 382..564 CDD:239746 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.