DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and lnx1

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017950997.2 Gene:lnx1 / 100487348 XenbaseID:XB-GENE-952178 Length:742 Species:Xenopus tropicalis


Alignment Length:100 Identity:30/100 - (30%)
Similarity:52/100 - (52%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLVPVSRLMRNML 76
            ||::|:|.||...|.:|: .:.|.|.:|..|:..:::.:..|||||..:|.......:.|::|:|
 Frog    40 VDDDLLCNICLHALIQPL-DTPCGHTYCTLCLTSFLVHEDFCPVDRKHILLQTCKKSTILVKNLL 103

  Fly    77 SRLKIKCTFSQ--SGCAQMLALEE-FRTHVAACEH 108
            .:|.:.|.|.:  :...|...||| |:.......|
 Frog   104 DKLPVICPFKEHCTDIVQRCDLEEHFQNRCKGASH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 10/36 (28%)
USP8_interact 137..319 CDD:286082
lnx1XP_017950997.2 mRING-HC-C3HC3D_LNX1 43..84 CDD:319693 13/41 (32%)
PDZ_signaling 282..366 CDD:238492
PDZ_signaling 390..470 CDD:238492
PDZ_signaling 516..>585 CDD:238492
PDZ_signaling 651..735 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.