DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and pdzrn3a

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_001921128.3 Gene:pdzrn3a / 100149029 ZFINID:ZDB-GENE-090313-307 Length:1033 Species:Danio rerio


Alignment Length:267 Identity:71/267 - (26%)
Similarity:116/267 - (43%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHL 65
            |||||:...|.||.:|||.:|..|||:|: ::.|.|.||.||..:|:.:...|||....:....|
Zfish     1 MGFDLDRFEGPVDPDLICKLCGKVLEDPL-ATPCGHVFCAACALQWLSKVNSCPVQCQKISNKEL 64

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNP-------------------- 110
            ..|..| :|::.:|.|||...:.|||:::.|:....|...|:.:|                    
Zfish    65 NQVLPL-KNLILKLDIKCDHRERGCARVMKLQHLAEHAEMCDFSPVRCRNEGCDAVLNLKDAASH 128

  Fly   111 -------KVVVECSKGCG-MKVPKDEMSRHNCVFELR-----------ELVEKLAKEVSDLKQKQ 156
                   :.:..|..||| |..||:....|:|:..|:           .|.::|.::.....:::
Zfish   129 LQETCEYRALEVCKNGCGLMLTPKEMSGEHSCLQALKAHGGLLQTKAQSLEKELKRQALSFSKRE 193

  Fly   157 SDMEEQSSSQRREMEL----FQYYIAALRS-----TNP-MLRNIGEQLDRFSLMQWGHGLPLANI 211
            ..:..:.|:...|:.:    ||..|...:|     ||. |.|:.||:...|.:          .:
Zfish   194 RSLLSKLSALHCELHITALTFQKKITEYKSRIDALTNSWMPRDQGEETMSFKV----------TL 248

  Fly   212 H-TWGSL 217
            | |.|||
Zfish   249 HKTSGSL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/36 (39%)
USP8_interact 137..319 CDD:286082 21/103 (20%)
pdzrn3aXP_001921128.3 RING 15..76 CDD:302633 22/62 (35%)
Sina 76..>131 CDD:302762 11/54 (20%)
PDZ 242..334 CDD:214570 6/24 (25%)
PDZ_signaling 422..503 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.