DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf1

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001121853.1 Gene:traf1 / 100148503 ZFINID:ZDB-GENE-071120-4 Length:551 Species:Danio rerio


Alignment Length:192 Identity:42/192 - (21%)
Similarity:86/192 - (44%) Gaps:40/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQ---IC----------PVDRSGLLTSHL 65
            ::.:|..|.:||.: .:.:.|.|.:|.||:: |:::..   :|          ..|.|.|..:..
Zfish    38 DKYLCSNCNNVLNK-ARQTVCGHRYCLACVN-WLVRNNKDLVCTKCKGEDSNVESDTSVLTPNQF 100

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            .....:.:.:|. ||:.|  :..||.....|:.|..|.:.||:   .::.|:.|||:.|.:..::
Zfish   101 FNDVAINKEILD-LKVHC--ANQGCPWRSTLKNFEDHQSQCEY---ALIPCNIGCGIMVQRKTLA 159

  Fly   131 RH-------------NC--VFELRELVEKLAKEVSDLKQKQSDMEEQ----SSSQRREMELF 173
            .|             :|  |...|||.:.:.....|.|..::|.:::    ::|:::|..:|
Zfish   160 THLESGCPNNKTACPSCTSVLTPRELQKHVCPSSGDKKTAKTDKKQKNNQPANSKKKEPCIF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 11/49 (22%)
USP8_interact 137..319 CDD:286082 9/41 (22%)
traf1NP_001121853.1 zf-TRAF 134..188 CDD:280357 14/56 (25%)
TRAF_BIRC3_bd 320..375 CDD:293278
MATH_TRAF1 402..548 CDD:239748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.