DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and rnf151

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 / 100004674 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio


Alignment Length:200 Identity:51/200 - (25%)
Similarity:95/200 - (47%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |::::..|...|::|||.||..||..||: .:|.|.||:.||.:||.::..||..|..:..:.::
Zfish     4 GYEVDQFVDPPDDDLICVICRAVLRCPVR-LKCNHVFCKECILQWMKRQVKCPCCRQSIDQNQML 67

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVE---------------- 115
            .:.:|.:: :.||.:||...|.||.....|.....|::.|.:..::...                
Zfish    68 VLFKLSKS-IGRLSVKCRNGQQGCRATFPLSNEYLHISTCPYEWQICPHEGCGQQVLRKDVQAHD 131

  Fly   116 ---------CSKGCGMKVPKDEMSRHNCVFEL--RELVEKLAKE--VSDLKQKQSDMEEQSSSQR 167
                     |..|||..:.::..::|||..||  |.|.|:..:.  .::|::|...|:.:.:..:
Zfish   132 QSCTHWRQLCPMGCGTLLVRENQTQHNCYRELQQRYLAERRKQRAIAANLRRKMQRMQSRMAQIK 196

  Fly   168 REMEL 172
            |::.|
Zfish   197 RQINL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 16/36 (44%)
USP8_interact 137..319 CDD:286082 9/39 (23%)
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 17/38 (45%)
zf-TRAF 102..157 CDD:280357 6/54 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.