Sequence 1: | NP_001285905.1 | Gene: | CG9014 / 34777 | FlyBaseID: | FBgn0028847 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001343919.2 | Gene: | rnf151 / 100004674 | ZFINID: | ZDB-GENE-121214-234 | Length: | 243 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 51/200 - (25%) |
---|---|---|---|
Similarity: | 95/200 - (47%) | Gaps: | 31/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
Fly 67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVE---------------- 115
Fly 116 ---------CSKGCGMKVPKDEMSRHNCVFEL--RELVEKLAKE--VSDLKQKQSDMEEQSSSQR 167
Fly 168 REMEL 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9014 | NP_001285905.1 | zf-C3HC4 | 18..55 | CDD:278524 | 16/36 (44%) |
USP8_interact | 137..319 | CDD:286082 | 9/39 (23%) | ||
rnf151 | XP_001343919.2 | RING_Ubox | 20..58 | CDD:327409 | 17/38 (45%) |
zf-TRAF | 102..157 | CDD:280357 | 6/54 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170594955 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15315 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.850 |