DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpo3 and hasp-2

DIOPT Version :9

Sequence 1:NP_609667.2 Gene:Gpo3 / 34776 FlyBaseID:FBgn0028848 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_490768.3 Gene:hasp-2 / 171659 WormBaseID:WBGene00021214 Length:434 Species:Caenorhabditis elegans


Alignment Length:161 Identity:37/161 - (22%)
Similarity:61/161 - (37%) Gaps:47/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LPTLETQVSLPRYFGSGHYG-LLSPALKNDDLTVYMVPFEN---------------HMVLGSREV 301
            |||........:..|.|.|| :.|.......:.:.::||||               |.|| |..:
 Worm    98 LPTSALDARKVKKLGEGAYGEVFSTVWNGRPVAIKVLPFENNGCFYGNQSVEIPTTHAVL-SEVI 161

  Fly   302 DLDEVSSRGSP-----TPDPDDVDCLLEAAKKRMDPCVELGRC--HVLSAWTAIKASVSCPTDKE 359
            .:.|:|:...|     ||:      .:|....:    :.:|..  .:|.||.|.        ||.
 Worm   162 VMKELSALRDPNSWNSTPN------FIEMISAQ----IVMGEYPKGLLRAWDAY--------DKL 208

  Fly   360 NDD-----DKRGTPINSYMIEVSPDGLITLA 385
            |:.     |...:...::::.||.:|.|:||
 Worm   209 NESEHLRPDVYSSEHQNFILFVSANGGISLA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpo3NP_609667.2 GlpA 7..554 CDD:223651 37/161 (23%)
DAO_C 417..537 CDD:293506
hasp-2NP_490768.3 Haspin_kinase 75..377 CDD:372050 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0578
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.