DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18507 and tmem268

DIOPT Version :9

Sequence 1:NP_723827.1 Gene:CG18507 / 34775 FlyBaseID:FBgn0028527 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_005170158.1 Gene:tmem268 / 559789 -ID:- Length:350 Species:Danio rerio


Alignment Length:365 Identity:76/365 - (20%)
Similarity:132/365 - (36%) Gaps:96/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 QHNGGGANGTGISQPADQGSGMRTIELSTGRIREGFANGDVIVTLLPANTKWPWITPAIFRPELV 254
            :....|.:.||.|:.|.:.....|           :.||..:.: :|.::   |.||. |.....
Zfish    11 EEKSDGKSPTGQSRTAGEPGTSST-----------WRNGQCVAS-VPTSS---WFTPK-FDFSRC 59

  Fly   255 PEELMAQGLTLTVEDYVNAMETLVNDY----RFTVYNICYKRILVCWILFAFTVLLALLFSGLQG 315
            ...|..:|..:..:::...:| |..|:    |:.::|......::..||  :.||...::|.|..
Zfish    60 RTLLETKGFQIPADNFEGPLE-LALDHPSVRRYLLFNSYVFNFIMAPIL--YMVLWCAVYSTLHM 121

  Fly   316 VALFALGVGW---LFLNAAAIFLCMWVKL-------RLSRGLEKCLARVNRQLMRHKILLVLDD- 369
            ....:....|   |.::..:|.|...:.|       .::...:..|..||.:::||.:||.:.| 
Zfish   122 YLQSSTASFWVLCLCVSLVSIILTAVISLIFHYSNREINMNTDVRLVGVNERMIRHGLLLGVADW 186

  Fly   370 ----RGRISCHKVNLCFMYFDATQCVNFLNEFLEH----------------------TEQTGGD- 407
                ||     |:.|..:|:|.:.|:..|.|.|::                      ||.|..| 
Zfish   187 VHKCRG-----KLQLFCVYWDLSPCLRSLTESLDNMSFFSDQVQNKLKKRMSHLVLVTEVTTLDP 246

  Fly   408 ---------------AIKAGWEAKLDIDLNDIVIQGSQPVRMPR----KQAVAQELFLSYLQRWG 453
                           .:.||.|....|...|..........||.    .|.:||:|.::|...:.
Zfish   247 EAGLQDEGFPEEEQPLLVAGRERSESISQRDDSKLTKNFSLMPNTRLSNQVIAQQLLMAYSALYV 311

  Fly   454 KDFLRRRLDWTVQE-----AGVHETPRHLQSSICPCQYEE 488
            :..:..:|  ||..     ||    ..|...|:|.|:|.|
Zfish   312 RLLVSNKL--TVPSHRPSGAG----KNHCGPSVCLCEYVE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18507NP_723827.1 DUF4481 227..>418 CDD:291466 50/247 (20%)
tmem268XP_005170158.1 DUF4481 36..345 CDD:291466 69/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31193
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5486
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.