DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18507 and Tmem268

DIOPT Version :9

Sequence 1:NP_723827.1 Gene:CG18507 / 34775 FlyBaseID:FBgn0028527 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001343283.1 Gene:Tmem268 / 230279 MGIID:1913920 Length:342 Species:Mus musculus


Alignment Length:362 Identity:90/362 - (24%)
Similarity:136/362 - (37%) Gaps:90/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PADQGSG---MRTIELSTGRIREG--------FANGDVIVTLLPANTKWPWITPAIFRPELVPEE 257
            |.|.|..   :.|..|....:.:|        ..||.|:..|...||    ..|..|......|:
Mouse     6 PTDPGGAAGPLPTSTLGCNILPQGNPPGWGQELHNGQVLTVLRIDNT----CAPISFDLGAAEEQ 66

  Fly   258 LMAQGLTLTVEDYVNAMETLVND---YRFTVYNICYKRILVCWILFAFTVLLALLFSGLQGVALF 319
            |.|.|:.:..|.|.|..|:.:.:   .|:.:||....|:... ::| :.::.|.::|..|   :|
Mouse    67 LQAWGIQVPAEQYRNLAESALLEPQVRRYIIYNSRPMRLAFA-VVF-YVLVWANIYSTSQ---MF 126

  Fly   320 ALGVGW---LFLNAAAIFLCMWVKLRLSRGLEKC-------LARVNRQLMRHKILLVLDDRGRIS 374
            |||..|   |....||..|.:.:.|...|...|.       |...|..|:||::||.:.|... .
Mouse   127 ALGNQWAGVLLATLAAFSLTLTLVLVFERQQRKANTNTDLRLVAANGALLRHRVLLGVTDTVE-G 190

  Fly   375 CHKV-NLCFMYFDATQCVNFLNEFLEHTE------------------QTGGDAIKAGWEAKLDID 420
            |..| .|.|:|||...||.||::.::..:                  :||...:..|.|     |
Mouse   191 CQSVIQLWFVYFDLENCVQFLSDHVQEMKRSQESLLRSRLSQLCVVMETGVSPVVEGPE-----D 250

  Fly   421 LNDIVIQGSQPVRMPR-----------KQAVAQELFLSYLQRWGKDFLR----RRLDWTVQEAGV 470
            |.|..:..|.|....|           .:|..:|:....|..:|..:.|    .||.   |..|.
Mouse   251 LEDAPLLPSTPGPQERPLTQTELYQLVPEAEPEEMARQLLAVFGGYYTRLLVTSRLP---QSMGT 312

  Fly   471 HETPRHLQSS--ICPCQYEEELLRNKIKISLQHRHCC 505
                ||:.|:  .||||.        |::.:....||
Mouse   313 ----RHMDSARIPCPCQL--------IEVHVLGTGCC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18507NP_723827.1 DUF4481 227..>418 CDD:291466 59/222 (27%)
Tmem268NP_001343283.1 DUF4481 39..328 CDD:373305 81/318 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..267 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843013
Domainoid 1 1.000 57 1.000 Domainoid score I10907
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto92193
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5486
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.