DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18507 and TMEM268

DIOPT Version :9

Sequence 1:NP_723827.1 Gene:CG18507 / 34775 FlyBaseID:FBgn0028527 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_011516652.1 Gene:TMEM268 / 203197 HGNCID:24513 Length:409 Species:Homo sapiens


Alignment Length:442 Identity:101/442 - (22%)
Similarity:160/442 - (36%) Gaps:119/442 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PGEVQPHAPPPDVAPAVLTTESTHVNLSASGSGIVSGASANASASGYAPGPVRHTPQLPNQKAAA 175
            ||...| .||                 |:.|...:.|    .|..|:....:.:.|:.       
Human     9 PGATGP-LPP-----------------SSPGWSALPG----GSPPGWGQAAIENMPKY------- 44

  Fly   176 APSLSSA----GAASSGHQHNGGGANGTGISQPAD---------------QGSGMRTIELSTGRI 221
             |.||||    |...|         .|..:|.|.|               ||.....::.....:
Human    45 -PVLSSAWLKPGILES---------QGWNLSHPPDLLAADQWLTGPCTVVQGDLDPFVQFLYLEL 99

  Fly   222 REGFANGDVIVTLLPANTKWPWITPAIFRPELVPEELMAQGL-TLTVEDYVNAMETLVND---YR 282
            :....||.|:..|...||    ..|..|......|:|...|: .:..:.|.:..|:.:.:   .|
Human   100 QAELHNGQVLTVLRIDNT----CAPISFDLGAAEEQLQTWGIQQVPADQYRSLAESALLEPQVRR 160

  Fly   283 FTVYNICYKRILVCWILFAFTVLLALLFSGLQGVALFALGVGW---LFLNAAAIFLCMWVKLRLS 344
            :.:||....|:... ::| :.|:.|.::|..|   :||||..|   |.:..||:.|.:.:.|...
Human   161 YIIYNSRPMRLAFA-VVF-YVVVWANIYSTSQ---MFALGNHWAGMLLVTLAAVSLTLTLVLVFE 220

  Fly   345 RGLEKC-------LARVNRQLMRHKILLVLDDRGRISCHKV-NLCFMYFDATQCVNFLNEFLEHT 401
            |..:|.       ||..|..|:||::||.:.|... .|..| .|.|:|||...||.||::.::..
Human   221 RHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVE-GCQSVIQLWFVYFDLENCVQFLSDHVQEM 284

  Fly   402 E------------------QTGGDAIKAGWEAKLDIDLNDIVIQGSQPVRMPRKQ---------A 439
            :                  :||.....|  |...:::...::...|.|...|..|         |
Human   285 KTSQESLLRSRLSQLCVVMETGVSPATA--EGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEA 347

  Fly   440 VAQELFLSYLQRWGKDFLRRRLDWTVQEA-GVHET--PRHLQSSICPCQYEE 488
            ..:|:....|..:|..::|..:...:.:| |...|  ||    ..||||..|
Human   348 EPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPR----IPCPCQLIE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18507NP_723827.1 DUF4481 227..>418 CDD:291466 58/223 (26%)
TMEM268XP_011516652.1 DUF4481 104..395 CDD:291466 76/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152929
Domainoid 1 1.000 57 1.000 Domainoid score I10966
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5486
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.