DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18507 and tmem268

DIOPT Version :9

Sequence 1:NP_723827.1 Gene:CG18507 / 34775 FlyBaseID:FBgn0028527 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_002937271.1 Gene:tmem268 / 100485830 XenbaseID:XB-GENE-989674 Length:324 Species:Xenopus tropicalis


Alignment Length:352 Identity:79/352 - (22%)
Similarity:132/352 - (37%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DQGSGMRTIELSTGR-IREGFANGDVIVTLLPANTKWPWITPAIFRPELVPEELMAQGLTLTVED 269
            |..|...|:.|.... :..|..||.::|.|       |: |.:..|.|....:|...|:.:.:|.
 Frog     5 DSESRSETVSLDPKESLHSGLYNGCLLVVL-------PY-TASSERMEQCLMKLQNFGIQVPLEQ 61

  Fly   270 YVNAME--TLVNDYRFTVYNICYKRILVCWILFA---FTVLLAL---------LFSGLQGVALFA 320
            ....::  .|:.:.|             .:|.|:   |.::|||         |:|..|   :|.
 Frog    62 CRECLQVSALIPELR-------------RYIFFSSRGFGMILALILYISIWVNLYSTAQ---MFL 110

  Fly   321 LGVGWL-----FLNAAAIFLCMWVKL-----RLSRGLEKCLARVNRQLMRHKILLVLDDRGRISC 375
            .|..||     .:.|||:.:.:.:.:     |::...:..||..|...|.|.:||.:.|..: .|
 Frog   111 GGQNWLSSIPVTIAAAAVTVAVILVINRHHKRINVNTDVTLAAANEIFMEHNVLLGISDLSQ-KC 174

  Fly   376 HKV-NLCFMYFDATQCVNFL------------NEFLEH---------TEQTG--GDAIKAGWEAK 416
            |.| :|||:||..:.|...|            .:.|||         .:|..  |.|.....|:.
 Frog   175 HSVPSLCFIYFHLSGCQQRLAQHLASMSKEAIRQCLEHLFIIVETPADQQLAQEGPAESTTEESP 239

  Fly   417 LDIDLNDI-------------VIQGSQPVRMPRKQAVAQELFL----SYLQRWGKDFLRRRLDWT 464
            |   |:|.             :||.|:|     ::.:|::|.:    .|::......|.|..:  
 Frog   240 L---LSDSPKEKPILCSKKVPLIQESEP-----EEEIARQLLVVSSACYVRLLITGLLPRGSE-- 294

  Fly   465 VQEAGVHETPRHLQSSICPCQYEEELL 491
            ....|:...|       ||||:.|..:
 Frog   295 TGHTGLINVP-------CPCQFIESTI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18507NP_723827.1 DUF4481 227..>418 CDD:291466 55/238 (23%)
tmem268XP_002937271.1 DUF4481 27..311 CDD:405486 73/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31193
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.