DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ics and RLP29

DIOPT Version :9

Sequence 1:NP_001285902.1 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_181808.1 Gene:RLP29 / 818880 AraportID:AT2G42800 Length:462 Species:Arabidopsis thaliana


Alignment Length:203 Identity:64/203 - (31%)
Similarity:103/203 - (50%) Gaps:34/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SNITRLTLSHNK--ISVISPGIANLLNLEILNLSNNQLT-ELPVSLSSMPKLRILNVSINRLI-N 110
            |::.:|:|..|.  ...|.|.|::|.:|:||.||.|:|| ::|.::.|:..|..|::|.|:|. .
plant   140 SSLQQLSLRSNPSLSGQIPPRISSLKSLQILTLSQNRLTGDIPPAIFSLKSLVHLDLSYNKLTGK 204

  Fly   111 LPRGFGAFPVLEVLDLSYNNLNEQVLPG-NFFGMETLRALYLGDND-FEYIPKEVGQLKNLQILG 173
            :|...|....|..||||||:|...:.|. :..||  |:.|.|..|. |..||:.|.:|::|..:.
plant   205 IPLQLGNLNNLVGLDLSYNSLTGTIPPTISQLGM--LQKLDLSSNSLFGRIPEGVEKLRSLSFMA 267

  Fly   174 LRDNDL-------------------------LELPREVGDLVRLRELHIQNNRLQ-VLPPEIAQL 212
            |.:|.|                         :.||.|:|.|.:|:||.::|:... |:|....:|
plant   268 LSNNKLKGAFPKGISNLQSLQYFIMDNNPMFVALPVELGFLPKLQELQLENSGYSGVIPESYTKL 332

  Fly   213 DLLSNKSV 220
            ..||:.|:
plant   333 TNLSSLSL 340

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity