Sequence 1: | NP_001285902.1 | Gene: | ics / 34774 | FlyBaseID: | FBgn0028546 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326274.1 | Gene: | pidd1 / 571033 | ZFINID: | ZDB-GENE-081104-353 | Length: | 960 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 71/265 - (26%) |
---|---|---|---|
Similarity: | 122/265 - (46%) | Gaps: | 46/265 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QSCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSSFEELPGLF--------NMSNITRLTLSH 59
Fly 60 NKISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRLINLPRGFGAFPVLEVL 124
Fly 125 DLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDNDLLELPREVGDL 189
Fly 190 VRLRELHIQNNRLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLLGISHVIDYLKTETYKI 254
Fly 255 IYNRH 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ics | NP_001285902.1 | leucine-rich repeat | 29..51 | CDD:275380 | 5/29 (17%) |
leucine-rich repeat | 52..84 | CDD:275380 | 8/31 (26%) | ||
LRR_8 | 96..156 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 98..120 | CDD:275380 | 8/21 (38%) | ||
LRR | 119..>222 | CDD:227223 | 34/102 (33%) | ||
leucine-rich repeat | 121..145 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 146..168 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 169..191 | CDD:275380 | 10/21 (48%) | ||
pidd1 | XP_021326274.1 | LRR | <148..366 | CDD:227223 | 68/255 (27%) |
leucine-rich repeat | 154..188 | CDD:275380 | 7/43 (16%) | ||
leucine-rich repeat | 189..211 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 212..234 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 259..280 | CDD:275380 | 12/45 (27%) | ||
leucine-rich repeat | 281..303 | CDD:275380 | 10/21 (48%) | ||
leucine-rich repeat | 304..326 | CDD:275380 | 9/21 (43%) | ||
Peptidase_S68 | 462..501 | CDD:313651 | |||
DD | 846..932 | CDD:326335 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0617 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |