DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ics and Sur-8

DIOPT Version :10

Sequence 1:NP_609665.2 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster


Alignment Length:281 Identity:86/281 - (30%)
Similarity:126/281 - (44%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSS-------------FEELP--GLFNMSNIT 53
            |.:|.:.|..|:   :||.....|....|.|..|:|             |...|  |....:|:.
  Fly   357 SSVPATLKNCKS---MDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVY 418

  Fly    54 RLTLSHNKISVISPGI-ANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRLINLPRGFGA 117
            .:.|.||:|..|..|| :....|..||:..|.||.||:.:.:...:..||::.|.|..||.....
  Fly   419 SINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMN 483

  Fly   118 FPVLEVLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDNDLLEL 182
            ...||:|.||.|.|.:  :|.....:..||.|.|.:|..|.:|.|:|.|..||.|.|:.|.:..|
  Fly   484 LQNLEILILSNNMLKK--IPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITML 546

  Fly   183 PREVGDLVRLRELHIQNNRLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLLGISHVIDYL 247
            ||.:|.|..|..|.:..|.||.||.||..|:.|.|   :.:.:||.:..:  .:.|.:...:.||
  Fly   547 PRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLEN---LYINQNPGLEKL--PFELALCQNLKYL 606

  Fly   248 KTETYKI-IYNRHLQAGRSGP 267
            ..:...: .....:|||  ||
  Fly   607 NIDKCPLSTIPPEIQAG--GP 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
icsNP_609665.2 leucine-rich repeat 29..51 CDD:275380 7/36 (19%)
LRR <31..>208 CDD:443914 64/192 (33%)
leucine-rich repeat 52..84 CDD:275380 10/32 (31%)
leucine-rich repeat 98..120 CDD:275380 6/21 (29%)
leucine-rich repeat 121..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..168 CDD:275380 10/21 (48%)
leucine-rich repeat 169..191 CDD:275380 10/21 (48%)
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 55/182 (30%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
leucine-rich repeat 254..276 CDD:275380
leucine-rich repeat 277..299 CDD:275380
leucine-rich repeat 300..322 CDD:275380
leucine-rich repeat 323..345 CDD:275380
leucine-rich repeat 346..368 CDD:275380 3/10 (30%)
leucine-rich repeat 369..392 CDD:275380 7/22 (32%)
leucine-rich repeat 417..440 CDD:275380 7/22 (32%)
leucine-rich repeat 441..486 CDD:275380 14/44 (32%)
PPP1R42 472..617 CDD:455733 49/151 (32%)
leucine-rich repeat 487..507 CDD:275380 8/21 (38%)
leucine-rich repeat 510..532 CDD:275380 10/21 (48%)
leucine-rich repeat 556..578 CDD:275380 10/21 (48%)
leucine-rich repeat 603..626 CDD:275380 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.