DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ics and Lrch

DIOPT Version :9

Sequence 1:NP_001285902.1 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_609834.2 Gene:Lrch / 35041 FlyBaseID:FBgn0032633 Length:1135 Species:Drosophila melanogaster


Alignment Length:224 Identity:73/224 - (32%)
Similarity:109/224 - (48%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LADKGLSSFEELP-GLFNMSNITRLTLSHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSSM 95
            :||...:.|.||| .:...:.:..|.|.||.|..|...:..|.:|..|:|.:|||:.||..:..:
  Fly   103 IADLSRNRFAELPEEVTTFAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFL 167

  Fly    96 PKLRILNVSINRLINLPRGFGAF-PVLEVLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYI 159
            | |::|.||.|||.:||...|.. ..|..||.|||.|..                         :
  Fly   168 P-LQVLLVSNNRLTSLPDELGRLDQTLTDLDASYNQLAN-------------------------L 206

  Fly   160 PKEVGQLKNLQILGLRDNDLLELPREVGDLVRLRELHIQNNRLQVLPPEIAQLDLLSNKSVMKME 224
            |..:|:|::|:.|.||.|.||.||||: ..:.|..|.:.||::..||.||..:..|..   :::|
  Fly   207 PARLGELRSLRSLSLRSNHLLYLPREL-TCLSLISLDVSNNKIASLPLEIRHMSTLVE---LQLE 267

  Fly   225 ENPWVNPIAEQYLLGISHVIDYLKTETYK 253
            .||..:|.|...:.|:.||..:|:|:..|
  Fly   268 NNPLTSPPASLCMRGLVHVFKFLETQATK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
icsNP_001285902.1 leucine-rich repeat 29..51 CDD:275380 6/19 (32%)
leucine-rich repeat 52..84 CDD:275380 10/31 (32%)
LRR_8 96..156 CDD:290566 18/60 (30%)
leucine-rich repeat 98..120 CDD:275380 10/22 (45%)
LRR 119..>222 CDD:227223 30/102 (29%)
leucine-rich repeat 121..145 CDD:275380 7/23 (30%)
leucine-rich repeat 146..168 CDD:275380 3/21 (14%)
leucine-rich repeat 169..191 CDD:275380 11/21 (52%)
LrchNP_609834.2 LRR_8 124..179 CDD:290566 21/55 (38%)
LRR_4 124..161 CDD:289563 13/36 (36%)
leucine-rich repeat 124..146 CDD:275380 7/21 (33%)
leucine-rich repeat 147..167 CDD:275380 8/19 (42%)
leucine-rich repeat 169..192 CDD:275380 10/22 (45%)
leucine-rich repeat 193..215 CDD:275380 10/46 (22%)
leucine-rich repeat 216..237 CDD:275380 11/21 (52%)
leucine-rich repeat 238..260 CDD:275380 8/21 (38%)
leucine-rich repeat 261..279 CDD:275380 6/20 (30%)
CH 676..756 CDD:214479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.