DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ics and SPAC926.06c

DIOPT Version :9

Sequence 1:NP_001285902.1 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_594367.1 Gene:SPAC926.06c / 2543531 PomBaseID:SPAC926.06c Length:621 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:55/211 - (26%)
Similarity:92/211 - (43%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PVSAKMSKAKKVLDE---ARETHNPELDLADKGLSSFEE--LPGLFNMSNITRLTLSHNKISVIS 66
            ||...:|::..||.:   |..:...|...|:...|..|:  :....:.|.:..|..|..|:..|.
pombe   284 PVHKTLSQSVLVLSKDGNASSSGGTENQSANSSSSLMEKDAILSSSSWSQLLYLRCSSCKLKSIP 348

  Fly    67 PGI-ANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRL--------INLPRGFGAFPVLE 122
            ..: .:|.:|..|:||.|:|||:|.:|..:|:|..||::.|::        |:|..       |:
pombe   349 KNVFLSLQSLVSLDLSGNELTEIPYALGELPQLCSLNLASNKITGCRTFYHISLSH-------LQ 406

  Fly   123 VLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDN---DLLELPR 184
            :|.||.|:|..  |.|                 .|.:|       :|:.|.:|||   |::|..|
pombe   407 ILVLSRNHLTS--LSG-----------------LENVP-------SLEKLDIRDNSITDVVEFRR 445

  Fly   185 EVGDLVRLRELHIQNN 200
            .||: ....|.::..|
pombe   446 LVGN-TNFEEAYLSLN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
icsNP_001285902.1 leucine-rich repeat 29..51 CDD:275380 4/23 (17%)
leucine-rich repeat 52..84 CDD:275380 9/32 (28%)
LRR_8 96..156 CDD:290566 15/67 (22%)
leucine-rich repeat 98..120 CDD:275380 6/29 (21%)
LRR 119..>222 CDD:227223 22/85 (26%)
leucine-rich repeat 121..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..168 CDD:275380 2/21 (10%)
leucine-rich repeat 169..191 CDD:275380 10/24 (42%)
SPAC926.06cNP_594367.1 LRR 32..474 CDD:227223 55/211 (26%)
LRR_RI <357..>440 CDD:238064 32/115 (28%)
leucine-rich repeat 358..380 CDD:275380 10/21 (48%)
leucine-rich repeat 381..404 CDD:275380 6/22 (27%)
LRR_4 404..444 CDD:289563 17/72 (24%)
leucine-rich repeat 405..426 CDD:275380 10/46 (22%)
leucine-rich repeat 427..451 CDD:275380 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.