DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9254 and SLC17A9

DIOPT Version :9

Sequence 1:NP_609664.1 Gene:CG9254 / 34773 FlyBaseID:FBgn0028513 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:384 Identity:98/384 - (25%)
Similarity:181/384 - (47%) Gaps:28/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DYDWSQEKQGLILASFYIGYIVTHLPGGILADKFGGKWTLSLGIFFTAIFTLLTPVCIVYGGADA 146
            |:.|::::.|::|:||:.||.:|.:.||.|.|:.||:..:.|........|.:||:......|..
Human    54 DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHL 118

  Fly   147 LIVL--RVLMGLGEGTTFPALSVLLASWVPANERGMLGALVLGGGQMGSIAGNIISGYVLSSMDW 209
            ..:.  |:||||.:|..||||:.||:..|..:||....::|..|.|.|::....:...:|....|
Human   119 AFMTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGW 183

  Fly   210 PWVFYVFAIIALVWFVVFTLVCFSSPFTHPYIKPEERAFLAQEV---PPPDKNKPKTPFFAILTS 271
            ..:||....:.|:|..          :.:.|:..|:...||..|   ..|.....:.|:..:...
Human   184 QSIFYFSGGLTLLWVW----------YVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRK 238

  Fly   272 IPMWALISAQIGHDWGFYIMVSYLPKYMSDVLRFSIKSNGLYSSLPYVTMWIMSLLSGCVADQMI 336
            ..:||.:.:|:.....|:|::|:||.:..:.  |......:::.:|::.....||.||.::|.:|
Human   239 PAVWAAVVSQLSAACSFFILLSWLPTFFEET--FPDAKGWIFNVVPWLVAIPASLFSGFLSDHLI 301

  Fly   337 KRNCMSTTNTRKIMTGVAAFGPAVFMVAASYAG--CNRGMVVALFTITMGLMGTYYAGMKLTPLD 399
            .:...:.| .||:|.|:.....:||.:...:..  |..   |...:.::||....::|:.:...|
Human   302 NQGYRAIT-VRKLMQGMGLGLSSVFALCLGHTSSFCES---VVFASASIGLQTFNHSGISVNIQD 362

  Fly   400 MSPNYAGTLMAITNGIGAITGVVSPYLVGVMTPNATLLEWRLVFWVAFGVLVVTAIVYC 458
            ::|:.||.|..:.|..||:.|||...|.|.:.  .|...|..:|.:   |.:::.:..|
Human   363 LAPSCAGFLFGVANTAGALAGVVGVCLGGYLM--ETTGSWTCLFNL---VAIISNLGLC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9254NP_609664.1 2A0114euk 28..466 CDD:129972 98/384 (26%)
MFS 82..461 CDD:119392 98/384 (26%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 90/347 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.