DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9254 and MFS18

DIOPT Version :9

Sequence 1:NP_609664.1 Gene:CG9254 / 34773 FlyBaseID:FBgn0028513 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:399 Identity:94/399 - (23%)
Similarity:183/399 - (45%) Gaps:41/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 WSQEKQGLILASFYIGYIVTHLPGGILADKFGGKWTLSLGIFFTAIFTLLTPVCIVYGGA----- 144
            ||:...|.:|:||:.||.:|.:.||..:|:|||:..:.......::.|.|.|..|...|:     
  Fly    60 WSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMPTIIWTAGSIKSYA 124

  Fly   145 -DALIVLRVLMGLGEGTTFPALSVLLASWVPANERGMLGALVLGGGQMGSIAGNIISGYVLSSMD 208
             ..::.:|:|.|..:|..||::..|.:..:..|||.....|:..|..:|::...|:..::|....
  Fly   125 IPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTLLTGIMGSFLLDYFG 189

  Fly   209 WPWVFYVFAIIALVWFVVFTLVCFSSPFTHPYIKPEERAFLAQEVPP----PDKNKPKT---PFF 266
            |.:||.|..::.:.|.:|...          |....||..:.....|    .:|:..:|   |:.
  Fly   190 WSYVFRVIGLMGIAWALVLRY----------YAMAGERNRIINIATPSRLCANKSPAETSAVPWL 244

  Fly   267 AILTSIPMWALISAQIGHDWGFYIMVSYLPKYMSDVLRFSIKSNGLYSSLPYVTMWIMSLLSGCV 331
            .....:..||.:.........|::::|:||.|..|  .|......:.:.:|::.:...:|.:..:
  Fly   245 RYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFHD--GFPHAKGWVVNMIPWLALPPCTLFAKYL 307

  Fly   332 ADQMIKRNCMSTTNTRKIMTG--VAAFGPAVFMVAASYAGCNRGMVVALFTITMGLMGTYYAGMK 394
            ..:::.|. ..||..||::..  .||...|:|:::.:   .:....:...||.:|..|.:...:.
  Fly   308 TTRLLARE-WHTTTVRKVIQSCCFAAQNLALFVMSRT---SDFHTALICMTIIIGGTGFHNNAVT 368

  Fly   395 LTPLDMSPNYAGTLMAITNGIGAITGVVSPYLVGVMTPNATLLE----WRLVFWVAFGVLVVTAI 455
            :.|.|::|.::|::..:.|.:|||.|.:..||.|      .:||    |.:||..|.|:.:|..|
  Fly   369 VNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAG------HILELTQSWPMVFSAAAGINLVGWI 427

  Fly   456 VYCIWASGD 464
            ::.::.|.:
  Fly   428 IFIVFGSAE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9254NP_609664.1 2A0114euk 28..466 CDD:129972 94/399 (24%)
MFS 82..461 CDD:119392 93/394 (24%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 93/393 (24%)
MFS_1 32..397 CDD:284993 81/352 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452012
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.