Sequence 1: | NP_609664.1 | Gene: | CG9254 / 34773 | FlyBaseID: | FBgn0028513 | Length: | 481 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_592802.1 | Gene: | mfs2 / 2542991 | PomBaseID: | SPAC11D3.05 | Length: | 546 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 317 | Identity: | 68/317 - (21%) |
---|---|---|---|
Similarity: | 96/317 - (30%) | Gaps: | 135/317 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 PDDQSDP-------------------------SSTFEGGDYDWSQEKQGLILAS------FYIGY 101
Fly 102 IVTHLPGGILADKFG-----------------------GKWTLSLGIFFTAIF------------ 131
Fly 132 -TLLTPVCIVYGGADALIVLRVLMGLGEGTTFPALSVLLASWVPANERGMLGALVLGGGQMGSIA 195
Fly 196 GNIISGYVLSS-MDWPWVFYVFAIIALVW---FVVFTLVCFSSPFTHPYIKPEERAFLAQEVPPP 256
Fly 257 DKNKPKTPFFAI--LTSIPMWALISA-----------QIGHDWGFYIMVSYLPKYMS 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9254 | NP_609664.1 | 2A0114euk | 28..466 | CDD:129972 | 68/317 (21%) |
MFS | 82..461 | CDD:119392 | 61/278 (22%) | ||
mfs2 | NP_592802.1 | MFS | 109..530 | CDD:119392 | 64/299 (21%) |
MFS_1 | 112..493 | CDD:284993 | 64/296 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |