DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and ADAM21

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_003804.2 Gene:ADAM21 / 8747 HGNCID:200 Length:722 Species:Homo sapiens


Alignment Length:403 Identity:101/403 - (25%)
Similarity:146/403 - (36%) Gaps:151/403 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 LGLAWVASASGASGGICEKYKTYTETVGGQYQSTKRSLNTGIITFVNYNSRVPPKVSQLTLAHEI 606
            ||||:||       |||   :...:.....:|....||      |.|            |:|||:
Human   307 LGLAYVA-------GIC---RPPIDCGVDNFQGDTWSL------FAN------------TVAHEL 343

  Fly   607 GHNFGSPHDYPQE---CRPGGLNGNYIMFASATSGDRPNNSKFSPCS--------------IRNI 654
            ||..|..||  :|   |...|...|..         |....||:.||              :.|.
Human   344 GHTLGMQHD--EEFCFCGERGCIMNTF---------RVPAEKFTNCSYADFMKTTLNQGSCLHNP 397

  Fly   655 SNVLDVLVGNTKRDCFKASEGAFCGNKIVESGEECDCGFNEEEC-KDKCCYPRLISEYDQSLNSS 718
            ..:.::.:  .||          |||.:||..|:|||| :.::| :|.||.          ||  
Human   398 P
RLGEIFM--LKR----------CGNGVVEREEQCDCG-SVQQCEQDACCL----------LN-- 437

  Fly   719 AKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKCKEE-TECSWSSTCNGTTAECPEPRHRDDK 782
               ||.|....|  :.|.||  ..|.|:|:.  :.|::| .||.....||||:.:|||.|:..|.
Human   438 ---CTLRPGAAC--AFGLCC--KDCKFMPSG--ELCRQEVNECDLPEWCNGTSHQCPEDRYVQDG 493

  Fly   783 TMCNNGTALCIRGECSGSPCLLWNMTKCFLTSTTLPHVSKRKLCDLACQD--GNDTSTCRSTSEF 845
            ..|:: :|.|.:..|:..                          |..|::  |.|   .:|.|:.
Human   494 IPCSD-SAYCYQKRCNNH--------------------------DQHCREIFGKD---AKSASQN 528

  Fly   846 ADKYNIQKGGISLQPGSPCDNFQGYCDV----FLKCRAVDA-----------DGPLLRLKNLLLN 895
            ..|....:|           |..|:|.:    :|||...|.           |.|||: .:..|.
Human   529 CYKEINSQG-----------NRFGHCGINGTTYLKCHISDVFCGRVQCENVRDIPLLQ-DHFTLQ 581

  Fly   896 RKTLQTVAEWIVD 908
            ...:..|..|.:|
Human   582 HTHINGVTCWGID 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 35/151 (23%)
Reprolysin_2 450..659 CDD:290307 33/133 (25%)
Disintegrin 684..776 CDD:278623 32/93 (34%)
ADAM21NP_003804.2 Pep_M12B_propep 50..158 CDD:279848
Cysteine switch. /evidence=ECO:0000250 171..178
ZnMc_adamalysin_II_like 208..396 CDD:239797 32/127 (25%)
Reprolysin 209..398 CDD:279729 33/129 (26%)
Disintegrin 415..487 CDD:278623 32/93 (34%)
ACR 491..627 CDD:214743 28/146 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.