DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and adam28

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001070186.1 Gene:adam28 / 767749 ZFINID:ZDB-GENE-060929-532 Length:293 Species:Danio rerio


Alignment Length:285 Identity:57/285 - (20%)
Similarity:101/285 - (35%) Gaps:74/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LNEYISHYETLNYD-HEHIR--ASHNRARRSV-TKDQYVHLKFASHGRDFHLRLKRDLNTFSNKL 97
            |:..:.|...|:.. :|.:|  ..|:..:|.: ::...|.......|||..:.|:::....:...
Zfish    17 LDPSVGHIHELHRKVYEIVRPIGLHDLQKRDLQSRPDRVKYAMTLGGRDIEMHLQKNTGMLTKDY 81

  Fly    98 D--FYDSKG------PIDVSTDHIYEGEVIGDRNSYVFGSIHNGVFEGKIITERDAYYVE----- 149
            .  :|...|      |.|:...: |.|:::.|..|.|..|..:|: .|...|......:|     
Zfish    82 SETYYTEDGMLVTTTPADLDLCY-YHGKILNDSASLVSMSTCDGL-RGYFQTAEQRVLIEPLSED 144

  Fly   150 ----HAK-HYFPTNRTATTTPPSTSTTSSAT----------TATKSTQPT---RP------LAKS 190
                ||. .|...|.........|:||...:          |.::|:.||   |.      |...
Zfish   145 SDGDHAAFKYEDVNEATPRVCGVTNTTWDESGDGVPPRILKTRSRSSGPTLFQRQKYNEFFLVAD 209

  Fly   191 NTSTTAVNSKTE----------NFIKKIAESTTTSQQLPEY---TES-----SSSSTTTFPPTTE 237
            |.....:||..|          |||..:.:...|...|..:   |::     |::|..|....|:
Zfish   210 NREYKKLNSDLEKLRKRIFEIINFINNVYKEINTFVALTGFEVWTDNDKITVSAASGATLDSFTK 274

  Fly   238 YFEDEKERNAEDELDFHSIIYKESH 262
            :      ||::       :|.::.|
Zfish   275 W------RNSD-------LIKRQRH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798
Reprolysin_2 450..659 CDD:290307
Disintegrin 684..776 CDD:278623
adam28NP_001070186.1 Pep_M12B_propep 44..149 CDD:279848 20/106 (19%)
ZnMc_adamalysin_II_like 200..>293 CDD:239797 19/100 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.