DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam3a

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_064698.1 Gene:Adam3a / 57021 RGDID:621469 Length:740 Species:Rattus norvegicus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:96/253 - (37%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 YKTYTETVGGQY--QSTKRSLNTGIITFVNYNSRVPPKV-----SQLTLAHEIGHNFGSPHD--Y 616
            ||.:.:.||..|  .:.......||        .:.||.     ..:.|:..:|.|.|..:|  |
  Rat   280 YKDHPDYVGATYHGMACNPKFTAGI--------ALHPKTLGVEGFAIVLSQLLGINLGLTYDDIY 336

  Fly   617 PQECRPGGLNGNYIMFASATSGDRPNNSKFSPCSIRNISNV-----LDVLVGNTKRDCFKASEGA 676
            ...||    ....||..||...:  ....||.||:.....:     ||.|:...:.:.....:.|
  Rat   337 NCFCR----GSTCIMNPSAIHSE--GIKVFSSCSMDEFRQLASQPDLDCLLKTQETEVVALPQAA 395

  Fly   677 -FCGNKIVESGEECDCGFNEEECKDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLS 740
             .|||.|:|..|:||||..|.....|||              .::.||..:..:|  ..|.||..
  Rat   396 KVCGNYILEPPEQCDCGPAERCSHKKCC--------------KSEDCTLLSDAEC--GSGACCDK 444

  Fly   741 NSCTFVPTSYHQKCKEET-ECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGEC 797
            .:|......  :.|::.| :|.:...||||:..|.......|...|||.||.|.:|.|
  Rat   445 RTCKIAERG--RLCRKSTDQCDFPEFCNGTSEFCVADIKAADLEPCNNETAYCFKGVC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 29/130 (22%)
Reprolysin_2 450..659 CDD:290307 25/111 (23%)
Disintegrin 684..776 CDD:278623 25/92 (27%)
Adam3aNP_064698.1 Pep_M12B_propep 40..141 CDD:279848
Reprolysin 193..382 CDD:279729 28/115 (24%)
ZnMc_adamalysin_II_like 193..381 CDD:239797 27/114 (24%)
Disintegrin 404..480 CDD:278623 25/93 (27%)
ACR 483..615 CDD:214743 9/18 (50%)
EB 601..650 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.