DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam39

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001020551.3 Gene:Adam39 / 546055 MGIID:3045694 Length:756 Species:Mus musculus


Alignment Length:322 Identity:83/322 - (25%)
Similarity:114/322 - (35%) Gaps:94/322 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 RNSYNGPH-NAFCNEHMD-VSNFLNLHSLEDHSDFCLAYVFTYRDFTGGTLGLAWVASASGASGG 556
            :|...|.: |.|..|..| .:..||.....|     :|::|...||. ..||:|:|       ||
Mouse   277 KNHVQGRNINEFLVEFCDWKARSLNFRIPND-----IAHIFVNLDFQ-IYLGVAYV-------GG 328

  Fly   557 ICEKYKTYTETVGGQYQSTKRSLNTGIITFVN----YNSRVPPKVSQLTLAHEIGHNFGSPHDYP 617
            :|                 ..|.|.|:...:.    |...:        :|||||||.|..|| .
Mouse   329 VC-----------------LPSYNCGVDCLLGGNLFYFGHI--------IAHEIGHNLGMEHD-S 367

  Fly   618 QECRPGGLNGNYIMFASATSGDRPNNSKFSPCSIRNISNVLDVLVGNTKRDCFKAS--------- 673
            ..|..|   .|..:.|.|.:|    .||||.||.....         ||....|..         
Mouse   368 SSCTCG---RNVCLMAPADNG----ISKFSNCSYSYFW---------TKYPTAKCMHKEKKSIGI 416

  Fly   674 -EGAFCGNKIVESGEECDCGFNEEECKDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPC 737
             .|..||:.:|:.||:||||..:....|.||               .:.||.:....|  :.|.|
Mouse   417 LRGKLCGDGVVDDGEQCDCGSAKNCADDPCC---------------KRSCTLKDGAAC--AFGLC 464

  Fly   738 CLSNSCTFVPTSYHQKC-KEETECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGECS 798
            |  ..|..:...  ..| |.:.||.....|||.:.:||...:..|.:.|.:| ..|....|:
Mouse   465 C--KYCQIMEAG--TVCRKRDNECDLPEWCNGHSHKCPNDVYLLDGSPCRDG-GYCYEKRCN 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 50/198 (25%)
Reprolysin_2 450..659 CDD:290307 46/170 (27%)
Disintegrin 684..776 CDD:278623 25/92 (27%)
Adam39NP_001020551.3 Pep_M12B_propep 69..173 CDD:279848
Reprolysin 222..409 CDD:279729 49/186 (26%)
ZnMc_adamalysin_II_like 222..408 CDD:239797 49/185 (26%)
Disintegrin 428..501 CDD:278623 25/93 (27%)
ACR 504..640 CDD:214743 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.