DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam5

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:XP_006253383.1 Gene:Adam5 / 498654 RGDID:621471 Length:773 Species:Rattus norvegicus


Alignment Length:170 Identity:47/170 - (27%)
Similarity:68/170 - (40%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 FSPCSI--------RNISNVLDVLVGNTKRDCFKASE-GAFCGNKIVESGEECDCGFNEEECKDK 701
            ||.||:        :::..:.|:.:...|:   |.|. ...|||.|:|..|:||||..:.....|
  Rat   355 FSTCSLDDFKYLSTQDLECLQDLP
MERQKK---KPSRPRRICGNGILEMNEQCDCGTLKNCTHKK 416

  Fly   702 CCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKC-KEETECSWSST 765
            ||.|              ..|..::|..|  ..|.|| ...|...|.:.  .| |.:.||.:...
  Rat   417 CCDP--------------MSCRLKSKAVC--GSGECC-GQDCKVKPVNV--LCRKSKNECDFEEY 462

  Fly   766 CNGTTAECPEPRHRDDKTMCNNGTALCIRGEC--SGSPCL 803
            |||..|.|.......:...|::|.|.|..|.|  |.:.|:
  Rat   463 CNGNDAYCVPDTFARNGQYCDSGQAFCYSGLCMTSNNQCM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 8/39 (21%)
Reprolysin_2 450..659 CDD:290307 4/20 (20%)
Disintegrin 684..776 CDD:278623 27/92 (29%)
Adam5XP_006253383.1 Pep_M12B_propep 35..141 CDD:279848
Reprolysin 185..378 CDD:279729 5/22 (23%)
ZnMc_adamalysin_II_like 185..376 CDD:239797 4/20 (20%)
Disintegrin 399..474 CDD:278623 27/93 (29%)
ACR 477..620 CDD:214743 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.