DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam20

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001009548.1 Gene:Adam20 / 384806 MGIID:2152342 Length:760 Species:Mus musculus


Alignment Length:548 Identity:130/548 - (23%)
Similarity:188/548 - (34%) Gaps:197/548 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 LNLHSLEDHSDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICEKYKTYTETVGGQYQSTKRSL 579
            ||:....|     :|::|....| |..||||:|       |.:|                 ..|.
Mouse   300 LNIRIPND-----IAHLFVNHSF-GKFLGLAYV-------GTVC-----------------LPSH 334

  Fly   580 NTGIITFVNYNSRVPPKVSQLT--LAHEIGHNFGSPHDYPQECRPGGLNGNYIMFASATSGDRPN 642
            |.|:      :..:.|.:.|..  :|||||||.|..|| ...|..||:  ||.:.:|..|    .
Mouse   335 NCGV------DRLLGPNLFQFAHIIAHEIGHNLGMEHD-SSSCTCGGI--NYCLMSSTYS----F 386

  Fly   643 NSKFSPCSIRNI------SNVL---DVLVGNTKRDCFKASEGAFCGNKIVESGEECDCGFNEEEC 698
            |.:||.||..|.      :|.|   .:.:||.:..        ||||.:|:.||:|||| :...|
Mouse   387 NPEFSNCSYSNFWTTYATTNCL
RKEKMSIGNLQIQ--------FCGNGVVDDGEQCDCG-DRHMC 442

  Fly   699 -KDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKCKEE-TECS 761
             :|:||..|.      :||..| .|          :.|.|||  .|..:|..  ..|:|| .||.
Mouse   443 ERDQCCNSRC------ALNDGA-AC----------AFGLCCL--YCQIMPAG--TVCREEVNECD 486

  Fly   762 WSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGECSGSPCLLWNMTKCFLTSTTLPHVSKRKLC 826
            ....|||.:.:||...:..|.:.|.:| ..|....|:..                          
Mouse   487 LPEWCNGHSHKCPNDVYLLDGSPCRDG-GYCYEKRCNNR-------------------------- 524

  Fly   827 DLACQD-------GNDTSTCRSTSEFADKYNIQKGGISLQPGSPCDNFQGYC----DVFLKCRAV 880
            |..|:.       ..|.|..|..:...|::                   |.|    |.:|:|...
Mouse   525 DEQCKQIFGKEARSADHSCYRELNTQGDRF-------------------GNCGMIRDAYLRCHDS 570

  Fly   881 DADGPLLRLKNL-----LLNRKT-----LQTVAEWIVDNWYLVVLMGVAFIVVMGSFIKCCAVHT 935
            |.....::.:|:     |.:..|     |..|..|..|..:.:.:..:. ||..|:  .|...|.
Mouse   571 DILCGRVQCENVTRIPFLRDHSTVHWTHLNGVTCWGTDYHFGMTIPDIG-IVKDGT--DCGPEHV 632

  Fly   936 PSSNPKKRRARRI--------SETLRAPMNTLRRMQRHPNQRGAGPRSIPPPAHEAQHYSRGGD- 991
            ..:  ||..::.|        :.|::...|.|...                      |.:||.| 
Mouse   633 CIN--KKCVSKPIWLEQCSSKTCTMKGVCNNLHHC----------------------HCNRGWDP 673

  Fly   992 ------GRGGGGGGGGRHGGSRSHHQQH 1013
                  |.||....|...|...|  |||
Mouse   674 PHCLESGFGGSVDSGPPPGEEES--QQH 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 46/172 (27%)
Reprolysin_2 450..659 CDD:290307 44/154 (29%)
Disintegrin 684..776 CDD:278623 31/93 (33%)
Adam20NP_001009548.1 Pep_M12B_propep 57..173 CDD:366707
ZnMc_adamalysin_II_like 222..408 CDD:239797 43/150 (29%)
Disintegrin 429..501 CDD:365943 31/93 (33%)
ACR 505..641 CDD:214743 31/186 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.