DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam32

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001164053.1 Gene:Adam32 / 361170 RGDID:735114 Length:752 Species:Rattus norvegicus


Alignment Length:302 Identity:67/302 - (22%)
Similarity:104/302 - (34%) Gaps:93/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 SLEDHSDFCLAYVFTYRD---FTGGTLGLAWVASASGASGGICEKYKTYTETVGGQYQSTKRSLN 580
            :|..|.   :||:|.|.:   :.|.|.           .|.:|    |...:.|           
  Rat   267 TLRPHD---VAYLFIYNEQPNYMGATY-----------PGKMC----TAPYSAG----------- 302

  Fly   581 TGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDYPQECRPGG----LNGNYIMFASATSGDRP 641
               ||.  |...:..:...:.|...:|.:.|..:|.|::|....    :|...:.:....:    
  Rat   303 ---ITM--YPKDMTLEAFSVILTQMLGLSLGISYDNPEKCHCSEKVCIMNPRAMQYTGVKT---- 358

  Fly   642 NNSKFSPCSIRNISNVLDVLVGNTKRDCFKASEG---------------AFCGNKIVESGEECDC 691
                ||.||..:...             ||.:||               |.|||..||..|.|||
  Rat   359 ----FSNCSSNDFER-------------FKLNEGAKCLQNKP
EMQRSPRAVCGNGKVEGDEICDC 406

  Fly   692 GFNEEEC-KDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKCK 755
            | ::::| .:.||.|      ...:..|.|.|     ...||| ..||  ..|.|:|..:..:..
  Rat   407 G-SQQQCGANSCCEP------TSCVLKSGKAC-----DSMSPS-ATCC--KDCQFLPDKHECRPS 456

  Fly   756 EETECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGEC 797
            ....|..:..|||::.:||......:..:|..|..:|..|.|
  Rat   457 SNMYCDIAEVCNGSSGQCPPDIILSNGIICGEGGTVCYNGNC 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 30/179 (17%)
Reprolysin_2 450..659 CDD:290307 26/146 (18%)
Disintegrin 684..776 CDD:278623 27/92 (29%)
Adam32NP_001164053.1 Pep_M12B_propep 46..143 CDD:279848
Reprolysin 187..383 CDD:279729 30/170 (18%)
ZnMc_adamalysin_II_like 187..381 CDD:239797 30/168 (18%)
Disintegrin 399..478 CDD:278623 27/93 (29%)
ACR 482..621 CDD:214743 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.