DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and Adam24

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:XP_017455860.1 Gene:Adam24 / 290774 RGDID:1309066 Length:740 Species:Rattus norvegicus


Alignment Length:307 Identity:88/307 - (28%)
Similarity:121/307 - (39%) Gaps:86/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 AFCNEHMDVSNFLNLHSLEDHSDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICEKYKTYTET 567
            |||     :...:|.:|   ...:.:|::|....| |...|:|:|       |.:|.|      |
  Rat   278 AFC-----LWKTMNFNS---QMAYDIAHLFVNYTF-GDYFGIAFV-------GTVCNK------T 320

  Fly   568 VGGQYQSTKRSLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDYPQECRPGGLNGNYIMF 632
            .|   ....|......:|..:            .:|||||||.|.||| ...|..|  .|..:|.
  Rat   321 FG---CGVDRLFGDNFLTIGH------------IVAHEIGHNLGMPHD-GILCSCG--EGPCLMS 367

  Fly   633 ASATSGDRPNNSKFSPCSIRNI-SNVLDVLVGNTKRDCFK---ASEGAF----CGNKIVESGEEC 689
            |:..|     :.|.|.||...: :|:       .|:.|.:   :|...|    |||.:|:.||||
  Rat   368 ATMES-----SKKLSNCSYEFLWANI-------AKKSCLQ
REPSSSDIFPMKICGNGVVDDGEEC 420

  Fly   690 DCGFNEEEC--KDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQ 752
            |||  .:.|  ..:||.|..|      |.|.||         |  :.|.|| :..|...|:.  .
  Rat   421 DCG--SQSCGRNSRCCLPTCI------LKSGAK---------C--ASGLCC-NFKCQIQPSG--T 463

  Fly   753 KCK-EETECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGECS 798
            .|: :|.||.....||||:.||||.......|.| .|...|....|:
  Rat   464 LCRTKENECDLPEWCNGTSKECPEDTFVQAGTSC-LGNGYCYEKRCN 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 44/177 (25%)
Reprolysin_2 450..659 CDD:290307 41/156 (26%)
Disintegrin 684..776 CDD:278623 33/94 (35%)
Adam24XP_017455860.1 Pep_M12B_propep 42..160 CDD:396235
ZnMc_adamalysin_II_like 209..395 CDD:239797 43/168 (26%)
DISIN 415..490 CDD:214490 34/96 (35%)
ACR 492..628 CDD:214743 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.