DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and ADAM2

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001455.3 Gene:ADAM2 / 2515 HGNCID:198 Length:735 Species:Homo sapiens


Alignment Length:262 Identity:68/262 - (25%)
Similarity:103/262 - (39%) Gaps:68/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 YKTYTETVGGQYQSTKRSLNTGIITFVNYNSRV---PPKVS----QLTLAHEIGHNFGSPHDYPQ 618
            |:..:..||..:|        |.:...||...|   |..:|    .:.||..:..:.|..:|...
Human   271 YREKSNYVGATFQ--------GKMCDANYAGGVVLHPRTISLESLAVILAQLLSLSMGITYDDIN 327

  Fly   619 ECRPGG----LNGNYIMFASATSGDRPNNSKFSPCSIRNISNVLDVLVGNTKRDC---------- 669
            :|:..|    :|...|.|:..        ..||.||..:.::    .:...|..|          
Human   328 KCQCSGAVCIMNPEAIHFSGV--------KIFSNCSFEDFAH----FISKQKSQCLHNQPRLDPF 380

  Fly   670 FKASEGAFCGNKIVESGEECDCGFNEEECK---DKCCYPRLISEYDQSLNSSAKGCTRRAKTQCS 731
            ||  :.|.|||..:|:||||||| .|::|.   :.||              ....|..:|.:.| 
Human   381 FK--QQAVCGNAKLEAGEECDCG-TEQDCALIGETCC--------------DIATCRFKAGSNC- 427

  Fly   732 PSQGPCCLSNSCTFVPTSYHQKCKEE-TECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRG 795
             ::||||  .:|.|:  |..:.|:.. .||.....|||::|.|||..:......|.....:||.|
Human   428 -AEGPCC--ENCLFM--SKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLNQWICIDG 487

  Fly   796 EC 797
            .|
Human   488 VC 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 27/136 (20%)
Reprolysin_2 450..659 CDD:290307 23/108 (21%)
Disintegrin 684..776 CDD:278623 31/95 (33%)
ADAM2NP_001455.3 Pep_M12B_propep 42..140 CDD:279848
Reprolysin 178..375 CDD:279729 25/123 (20%)
ZnMc_adamalysin_II_like 178..373 CDD:239797 25/121 (21%)
DISIN 393..470 CDD:214490 32/97 (33%)
ACR 472..609 CDD:214743 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.