DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and tag-275

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_509031.2 Gene:tag-275 / 180886 WormBaseID:WBGene00016423 Length:472 Species:Caenorhabditis elegans


Alignment Length:332 Identity:72/332 - (21%)
Similarity:116/332 - (34%) Gaps:107/332 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 TCSLYIQTDPLIWRHIREGIA-------DHDRGRKYEVDEKTREEITSLIAHHVTAVNYIYRNTK 468
            :|..:.....|..:||..|.|       |:...   ..|..|...|.||          ::.:.|
 Worm    11 SCIFFNVVSTLEQKHIEYGAAVWGAKAPDYSLA---STDSGTTVFIRSL----------VFVDNK 62

  Fly   469 FDGRTEHRNIRFEVQRIKIDDDSACRNSYNGPHNAFCNE----------------HMDVSNF--- 514
            .....|...||.::..:|:.|::          |.:.|:                .:.:.:|   
 Worm    63 TTAYYEFDMIRVKLNIMKMVDEA----------NQYLNQLGVGLIVVGILQTNRGDLSLQSFHEY 117

  Fly   515 --LNLHSLEDHSDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICEKYKTYTETVGGQYQSTKR 577
              ..||.|.||.   .|.:.:|: :.|   |||:|       .|:|   .:::.::.|.|.:..|
 Worm   118 RNSRLHKLPDHE---FATLISYK-YAG---GLAYV-------NGMC---SSHSVSLSGFYPNEPR 165

  Fly   578 SLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDYPQE--------CRP-GGLNGNYIMFA 633
            ::  |.|.|                 ||:.|..|.||....|        |.| ..|..:..:..
 Worm   166 AM--GSIFF-----------------HEVAHLVGVPHRAVNESIYVPNCLCTPKDSLKEDGCLKI 211

  Fly   634 SATSGDRPNNSKFSPCSIRNISNVLDVLVGNTKRDCFKASEGAFCGNKIVESGEECDCGFNEEEC 698
            .....|         |:::...|.:.......|...|:.|| ..|||.::|:||:||||. ...|
 Worm   212 PGFDHD---------CTVQQFVNTIYKNKCILKHPIFEQSE-PVCGNGVLENGEDCDCGL-PGRC 265

  Fly   699 KDKCCYP 705
            .|..|.|
 Worm   266 SDLNCQP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 58/302 (19%)
Reprolysin_2 450..659 CDD:290307 44/238 (18%)
Disintegrin 684..776 CDD:278623 11/22 (50%)
tag-275NP_509031.2 ZnMc 57..234 CDD:381785 42/231 (18%)
Disintegrin 252..>277 CDD:385688 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.