DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and LOC105946911

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:XP_031754005.1 Gene:LOC105946911 / 105946911 -ID:- Length:233 Species:Xenopus tropicalis


Alignment Length:246 Identity:60/246 - (24%)
Similarity:91/246 - (36%) Gaps:77/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 PCSIRNISNVLDVLVGNTKRDCFKASEGAFCGNKIVESGEECDCGFNEEECKDKCCYPRLISEYD 712
            |.|:.::.:..:.|..|.            ||||:.|.||||||| ..:||||:||         
 Frog    10 PSSLGDVPDKTNFLRPNV------------CGNKLTEVGEECDCG-TVQECKDQCC--------- 52

  Fly   713 QSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKCKE--ETECSWSSTCNGTTAECPE 775
                 .|..|..:...||  ::|.||  ::|......  :.|:|  :.:|.....|:|.:..||.
 Frog    53 -----DAATCKLKPGAQC--AEGECC--SNCKIKAAG--EVCRERNDDDCDLEDVCDGKSPWCPS 106

  Fly   776 PRHRDDKTMCNNGTALCIRGECSGSPCL------LWNMTK------CF--------------LTS 814
            .|.:.:...|..|...|..|.|   |.:      ||....      ||              :.|
 Frog   107 DRFQANGAPCGKGEGYCYNGTC---PTMQRQCTSLWGDNTLVGEDLCFNKNMEGTDYGHCKNVGS 168

  Fly   815 TTLPHVSKRKLCD-LACQDGND----------TSTCRSTSEFADKYNIQKG 854
            |.:|...:..:|. |.|...|:          |..|::.  .|.:..:|.|
 Frog   169 TYIPCKPENVMCGVLYCNSDNEYPTVPGRVAVTGECKAL--LAPEGMVQNG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 4/28 (14%)
Reprolysin_2 450..659 CDD:290307 2/10 (20%)
Disintegrin 684..776 CDD:278623 29/93 (31%)
LOC105946911XP_031754005.1 Disintegrin 34..107 CDD:395147 29/93 (31%)
ACR 111..224 CDD:214743 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.