DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kuz and LOC102550654

DIOPT Version :9

Sequence 1:NP_477187.1 Gene:kuz / 34772 FlyBaseID:FBgn0259984 Length:1238 Species:Drosophila melanogaster
Sequence 2:XP_008769029.1 Gene:LOC102550654 / 102550654 RGDID:7726377 Length:193 Species:Rattus norvegicus


Alignment Length:117 Identity:31/117 - (26%)
Similarity:46/117 - (39%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 RDCFKASEGAFCGNKI----VESGEECDCGFNEEECKDKCCYPRLISEYDQSLNSSAKGCTRRAK 727
            :.|:|.:||   |:|.    ||:|       ....||.||..  :.|.:....::|.......||
  Rat    88 KSCYKQNEG---GSKYGYCHVENG-------THMPCKAK
CAL--MQSVWTWRRHTSQPTAPPSAK 140

  Fly   728 TQCSPSQGPCCL---SNSCTFVPTSYHQKC----KEETECSWSSTCNGTTAE 772
            .....::|.|.|   |:.|....:....||    ||.:|.:....|..|.||
  Rat   141 ATQLLNRGWCVLPHGSHICGDCYSDLSPKCQKKTKESSEATTHQGCQATQAE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuzNP_477187.1 ZnMc_TACE_like 410..677 CDD:239798 4/9 (44%)
Reprolysin_2 450..659 CDD:290307
Disintegrin 684..776 CDD:278623 24/96 (25%)
LOC102550654XP_008769029.1 Disintegrin <9..30 CDD:299186
ADAM_CR <81..>116 CDD:301627 11/37 (30%)
Peptidase_M14_like <123..>175 CDD:299699 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.